From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004074000
  • symbol?: recN
  • description?: DNA repair protein

      descriptions from strain specific annotations:

    • DNA repair protein
    • DNA repair protein RecN
    • putative DNA repair protein
  • strand?: -
  • coordinates?: 4356025..4357705
  • synteny block?: BlockID0031060
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1564 (recN)
    N315:
    SA1350 (recN)
    NCTC8325:
    Newman:
    NWMN_1425 (recN)
    USA300_FPR3757:
    04-02981:
    SA2981_1478 (recN)
    08BA02176:
    C248_1562
    11819-97:
    MS7_1537 (recN)
    71193:
    ST398NM01_1585
    ECT-R 2:
    ECTR2_1371 (recN)
    ED133:
    SAOV_1520 (recN)
    ED98:
    SAAV_1512 (recN)
    HO 5096 0412:
    SAEMRSA15_14400
    JH1:
    SaurJH1_1611
    JH9:
    SaurJH9_1578
    JKD6008:
    SAA6008_01489 (recN)
    JKD6159:
    SAA6159_01455 (recN)
    LGA251:
    SARLGA251_14260
    M013:
    M013TW_1535
    MRSA252:
    SAR1597
    MSHR1132:
    SAMSHR1132_13600
    MSSA476:
    SAS1458
    Mu3:
    SAHV_1507 (recN)
    Mu50:
    SAV1519 (recN)
    MW2:
    MW1472 (recN)
    RF122:
    SAB1392c
    ST398:
    SAPIG1585 (recN)
    T0131:
    SAT0131_01613
    TCH60:
    HMPREF0772_11621 (recN)
    TW20:
    SATW20_15160
    USA300_TCH1516:
    USA300HOU_1521 (recN)
    VC40:
    SAVC_06845

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLQTLSIKQFAIIEELEIQFSDGLTVLSGETGSGKSIIIDAIGQLIGMRASSDFVRHGEK
    N315            MLQTLSIKQFAIIEELEIQFSDGLTVLSGETGSGKSIIIDAIGQLIGMRASSDFVRHGEK
    NCTC8325        MLQTLSIKQFAIIEELEIQFSDGLTVLSGETGSGKSIIIDAIGQLIGMRASSDFVRHGEK
    Newman          MLQTLSIKQFAIIEELEIQFSDGLTVLSGETGSGKSIIIDAIGQLIGMRASSDFVRHGEK
    USA300_FPR3757  MLQTLSIKQFAIIEELEIQFSDGLTVLSGETGSGKSIIIDAIGQLIGMRASSDFVRHGEK
                    ************************************************************

    COL             KAVIEGIFDIDESKDAIHILKNMDIDVDEDFLLVKREIFSSGKSLCKINNQTVTLQDLRK
    N315            KAVIEGIFDIDESKDAIHILKNMDIDVDEDFLLVKREIFSSGKSLCKINNQTVTLQDLRK
    NCTC8325        KAVIEGIFDIDESKDAIHILKNMDIDVDEDFLLVKREIFSSGKSLCKINNQTVTLQDLRK
    Newman          KAVIEGIFDIDESKDAIHILKNMDIDVDEDFLLVKREIFSSGKSLCKINNQTVTLQDLRK
    USA300_FPR3757  KAVIEGIFDIDESKDAIHILKNMDIDVDEDFLLVKREIFSSGKSLCKINNQTVTLQDLRK
                    ************************************************************

    COL             VMQELLDIHGQHETQSLLKQKYHLTLLDNYAESRYQDLLDKYHQTFQNYKAKKQELEDLE
    N315            VMQELLDIHGQHETQSLLKQKYHLTLLDNYAESRYQDLLDKYHQTFQNYKAKKQELEDLE
    NCTC8325        VMQELLDIHGQHETQSLLKQKYHLTLLDNYAESRYQDLLDKYHQTFQNYKAKKQELEDLE
    Newman          VMQELLDIHGQHETQSLLKQKYHLTLLDNYAESRYQDLLDKYHQTFQNYKAKKQELEDLE
    USA300_FPR3757  VMQELLDIHGQHETQSLLKQKYHLTLLDNYAESRYQDLLDKYHQTFQNYKAKKQELEDLE
                    ************************************************************

    COL             SADQALLQRLDLMKFQLEELSEAHLKEGEIEQLEIDIKRIQNSEKLSLALNNAHMTLTDE
    N315            SADQALLQRLDLMKFQLEELSEAHLKEGEIEQLEIDIKRIQNSEKLSLALNNAHMTLTDE
    NCTC8325        SADQALLQRLDLMKFQLEELSEAHLKEGEIEQLEIDIKRIQNSEKLSLALNNAYMTLTDE
    Newman          SADQALLQRLDLMKFQLEELSEAHLKEGEIEQLEIDIKRIQNSEKLSLALNNAHMTLTDE
    USA300_FPR3757  SADQALLQRLDLMKFQLEELSEAHLKEGEIEQLEIDIKRIQNSEKLSLALNNAHMTLTDE
                    *****************************************************:******

    COL             NAITDRLYELSNHLLTINDIVPNKYDKLKEDIDQFYYILEDAKHELYDEMANTEFDEQVL
    N315            NAITDRLYELSNHLLTINDIVPNKYDKLKEDIDQFYYILEDAKHELYDEMANTEFDEQVL
    NCTC8325        NAITDRLYELSNHLLTINDIVPNKYDKLKEDIDQFYYILEDAKHELYDEMANTEFDEQVL
    Newman          NAITDRLYELSNHLLTINDIVPNKYDKLKEDIDQFYYILEDAKHELYDEMANTEFDEQVL
    USA300_FPR3757  NAITDRLYELSNHLLTINDIVPNKYDKLKEDIDQFYYILEDAKHELYDEMANTEFDEQVL
                    ************************************************************

    COL             NEYESRMNLLNNLKRKYGKDISELIAYQEKLNNEINKIENYEQSTSQLREEINALYNQVI
    N315            NEYESRMNLLNNLKRKYGKDISELIAYQEKLNNEINKIENYEQSTSQLREEINALYNQVI
    NCTC8325        NEYESRMNLLNNLKRKYGKDISELIAYQEKLNNEINKIENYEQSTSQLREEINALYNQVI
    Newman          NEYESRMNLLNNLKRKYGKDISELIAYQEKLNNEINKIENYEQSTSQLREEINALYNQVI
    USA300_FPR3757  NEYESRMNLLNNLKRKYGKDISELIAYQEKLNNEINKIENYEQSTSQLREEINALYNQVI
                    ************************************************************

    COL             EVGQALSKQRRIVARELRDHIVSEIQNLQMKDANLEISFKKLEEPNIDGIEFVEFLISPN
    N315            EVGQALSKQRRIVARELRDHIVSEIQNLQMKDANLEISFKKLEEPNIDGIEFVEFLISPN
    NCTC8325        EVGQALSKQRRIVARELRDHIVSEIQNLQMKDANLEISFKKLEEPNIDGIEFVEFLISPN
    Newman          EVGQALSKQRRIVARELRDHIVSEIQNLQMKDANLEISFKKLEEPNIDGIEFVEFLISPN
    USA300_FPR3757  EVGQALSKQRRIVARELRDHIVSEIQNLQMKDANLEISFKKLEEPNIDGIEFVEFLISPN
                    ************************************************************

    COL             KGEPLKSLNKIASGGELSRIMLALKSIFVKSRGQTAILFDEVDSGVSGQAAQKMAEKMRD
    N315            KGEPLKSLNKIASGGELSRIMLALKSIFVKSRGQTAILFDEVDSGVSGQAAQKMAEKMRD
    NCTC8325        KGEPLKSLNKIASGGELSRIMLALKSIFVKSRGQTAILFDEVDSGVSGQAAQKMAEKMRD
    Newman          KGEPLKSLNKIASGGELSRIMLALKSIFVKSRGQTAILFDEVDSGVSGQAAQKMAEKMRD
    USA300_FPR3757  KGEPLKSLNKIASGGELSRIMLALKSIFVKSRGQTAILFDEVDSGVSGQAAQKMAEKMRD
                    ************************************************************

    COL             IAEYIQVICISHLPQVASMSDHHLLISKSSKDDRTTTQVQELISDDKVDEIARMISGASV
    N315            IAEYIQVICISHLPQVASMSDHHLLISKSSKDDRTTTQVQELIGDDKVDEIARMISGASV
    NCTC8325        IAEYIQVICISHLPQVASMSDHHLLISKSSKDDRTTTQVQELISDDKVDEIARMISGASV
    Newman          IAEYIQVICISHLPQVASMSDHHLLISKSSKDDRTTTQVQELISDDKVDEIARMISGASV
    USA300_FPR3757  IAEYIQVICISHLPQVASMSDHHLLISKSSKDDRTTTQVQELISDDKVDEIARMISGASV
                    *******************************************.****************

    COL             TDLTRENAREMIQHNQRRR
    N315            TDLTRENAREMIQHNQRRR
    NCTC8325        TDLTRENAREMIQHNQRRR
    Newman          TDLTRENAREMIQHNQRRR
    USA300_FPR3757  TDLTRENAREMIQHNQRRR
                    *******************