From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004075000
  • symbol?: argR
  • description?: arginine repressor

      descriptions from strain specific annotations:

    • arginine repressor
    • arginine repressor ArgR
    • Arginine pathway regulatory protein ArgR, repressor of arg regulon
    • ArgR family transcriptional regulator
  • strand?: -
  • coordinates?: 4357721..4358173
  • synteny block?: BlockID0031070
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1565 (argR)
    N315:
    SA1351 (ahrC)
    NCTC8325:
    Newman:
    NWMN_1426 (ahrC)
    USA300_FPR3757:
    04-02981:
    SA2981_1479 (argR)
    08BA02176:
    C248_1563 (argR)
    11819-97:
    MS7_1538 (argR)
    71193:
    ST398NM01_1586
    ECT-R 2:
    ECTR2_1372 (argR)
    ED133:
    SAOV_1521
    ED98:
    SAAV_1513 (argR)
    HO 5096 0412:
    SAEMRSA15_14410 (argR)
    JH1:
    SaurJH1_1612
    JH9:
    SaurJH9_1579
    JKD6008:
    SAA6008_01490 (ahrC)
    JKD6159:
    SAA6159_01456 (ahrC)
    LGA251:
    SARLGA251_14270 (argR)
    M013:
    M013TW_1536
    MRSA252:
    SAR1598 (argR)
    MSHR1132:
    SAMSHR1132_13610
    MSSA476:
    SAS1459
    Mu3:
    SAHV_1508 (ahrC)
    Mu50:
    SAV1520 (ahrC)
    MW2:
    MW1473 (ahrC)
    RF122:
    SAB1393c (argR)
    ST398:
    SAPIG1586 (argR)
    T0131:
    SAT0131_01614
    TCH60:
    HMPREF0772_11620 (argR)
    TW20:
    SATW20_15170 (argR)
    USA300_TCH1516:
    USA300HOU_1522 (argR)
    VC40:
    SAVC_06850

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQ
    N315            MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQ
    NCTC8325        MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQ
    Newman          MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQ
    USA300_FPR3757  MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQ
                    ************************************************************

    COL             YVYSLPNDRKFHPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVL
    N315            YVYSLPNDRKFHPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVL
    NCTC8325        YVYSLPNDRKFHPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVL
    Newman          YVYSLPNDRKFHPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVL
    USA300_FPR3757  YVYSLPNDRKFHPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVL
                    ************************************************************

    COL             GTICGDDTCLIICRSKEASDEIKSRIFNLL
    N315            GTICGDDTCLIICRSKEASDEIKSRIFNLL
    NCTC8325        GTICGDDTCLIICRSKEASDEIKSRIFNLL
    Newman          GTICGDDTCLIICRSKEASDEIKSRIFNLL
    USA300_FPR3757  GTICGDDTCLIICRSKEASDEIKSRIFNLL
                    ******************************