From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1426 [new locus tag: NWMN_RS08050 ]
  • pan locus tag?: SAUPAN004075000
  • symbol: ahrC
  • pan gene symbol?: argR
  • synonym:
  • product: arginine repressor

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1426 [new locus tag: NWMN_RS08050 ]
  • symbol: ahrC
  • product: arginine repressor
  • replicon: chromosome
  • strand: -
  • coordinates: 1597981..1598433
  • length: 453
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    GTGCCCAAAAAATCGGTTAGGCATATAAAAATTAGAGAAATTATTTCAAATGAACAGATA
    GAGACACAAGATGAATTAGTTAAACGATTAAACGATTATGATTTAAATGTCACTCAAGCA
    ACTGTTTCTCGTGATATTAAAGAACTACAACTTATTAAAGTACCTATACCTTCAGGTCAA
    TATGTTTATAGTTTACCAAATGATAGAAAATTCCATCCTTTAGAAAAATTGGGACGTTAT
    TTAATGGATTCCTTTGTTAATATAGATGGTACTGATAATTTACTTGTTCTAAAAACATTA
    CCTGGTAATGCACAATCTATTGGAGCTATATTAGACCAAATCAATTGGGAAGAAGTACTA
    GGCACAATTTGTGGTGATGATACTTGTTTAATTATTTGTCGAAGCAAAGAGGCAAGTGAT
    GAAATCAAGTCAAGAATTTTCAATTTGTTATAA
    60
    120
    180
    240
    300
    360
    420
    453

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1426 [new locus tag: NWMN_RS08050 ]
  • symbol: AhrC
  • description: arginine repressor
  • length: 150
  • theoretical pI: 5.28159
  • theoretical MW: 17097.6
  • GRAVY: -0.267333

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismAmino acid biosynthesisGlutamate familyarginine repressor (TIGR01529; HMM-score: 169.8)
    Signal transductionRegulatory functionsDNA interactionsarginine repressor (TIGR01529; HMM-score: 169.8)
  • TheSEED:  
    Amino Acids and DerivativesArginine; urea cycle, polyaminesArginine and Ornithine Degradation Arginine pathway regulatory protein ArgR, repressor of arg regulon 
    Arginine; urea cycle, polyaminesArginine Biosynthesis extended Arginine pathway regulatory protein ArgR, repressor of arg regulon 
    Arginine; urea cycle, polyaminesArginine Deiminase Pathway Arginine pathway regulatory protein ArgR, repressor of arg regulon 
  • PFAM:
    HTH (CL0123) Arg_repressor; Arginine repressor, DNA binding domain (PF01316; HMM-score: 94.5)
    no clan definedArg_repressor_C; Arginine repressor, C-terminal domain (PF02863; HMM-score: 92.4)
    HTH (CL0123) HTH_11; HTH domain (PF08279; HMM-score: 17)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.138
    • Ymax_pos: 11
    • Cmax: 0.107
    • Cmax_pos: 24
    • Smax: 0.344
    • Smax_pos: 1
    • Smean: 0.151
    • D: 0.143
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQYVYSLPNDRKFHPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVLGTICGDDTCLIICRSKEASDEIKSRIFNLL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: AhrC (ArgR*)
    AhrC  (ArgR*) (TF) important in Arginine biosynthesis, Arginine degradationRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]