From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004113000
  • symbol?: gcvPA
  • description?: glycine dehydrogenase subunit 1

      descriptions from strain specific annotations:

    • glycine dehydrogenase subunit 1
    • Glycine dehydrogenase [decarboxylating] (glycine cleavage system P1 protein)
    • glycine cleavage system P-family protein
    • putative glycine cleavage system P-protein
    • glycine dehydrogenase [decarboxylating] subunit 1
    • glycine dehydrogenase, subunit 1 (glycine cleavage system P protein)
    • aminotransferase class-V family protein
    • glycine dehydrogenase (glycine cleavage system P1 protein )
    • glycine dehydrogenase (decarboxylating)
  • strand?: -
  • coordinates?: 4389051..4390397
  • synteny block?: BlockID0031430
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1440 (gcvPA)
    USA300_FPR3757:
    04-02981:
    SA2981_1494
    08BA02176:
    C248_1578
    11819-97:
    MS7_1553
    71193:
    ST398NM01_1601
    ECT-R 2:
    ECTR2_1387
    ED133:
    SAOV_1536
    ED98:
    SAAV_1528
    HO 5096 0412:
    SAEMRSA15_14560
    JH1:
    SaurJH1_1627
    JH9:
    SaurJH9_1594
    JKD6008:
    SAA6008_01505 (gcvPA)
    JKD6159:
    SAA6159_01471 (gcvPA)
    LGA251:
    SARLGA251_14420
    M013:
    M013TW_1551
    MRSA252:
    SAR1613
    MSHR1132:
    SAMSHR1132_13760
    MSSA476:
    SAS1474
    Mu3:
    SAHV_1523
    Mu50:
    SAV1536
    MW2:
    MW1488
    RF122:
    SAB1408c
    ST398:
    SAPIG1601
    T0131:
    SAT0131_01629
    TCH60:
    HMPREF0772_11605 (gcvP)
    TW20:
    SATW20_15320
    USA300_TCH1516:
    USA300HOU_1537 (gcvPA)
    VC40:
    SAVC_06925

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---MSHRYIPLTEKDKQEMLQTIGAKSIGELFGDVPSDILLNRDLNIAEGEAETTLLRRL
    N315            ---MSHRYIPLTEKDKQEMLQTIGAKSIGELFGDVPSDILLNRDLNIAEGEAETTLLRRL
    NCTC8325        ---MSHRYIPLTEKDKQEMLQTIGAKSIGELFGDVPSDILLNRDLNIAEGEAETTLLRRL
    Newman          MCIVSHRYIPLTEKDKQEMLQTIGAKSIGELFGDVPSDILLNRDLNIAEGEAETTLLRRL
    USA300_FPR3757  ---MSHRYIPLTEKDKQEMLQTIGAKSIGELFGDVPSDILLNRDLNIAEGEAETTLLRRL
                       :********************************************************

    COL             NRIASKNITKETHTSFLGAGVYDHYAPSVVDAMISRSEFYTAYTPYQPEISQGELQAIFE
    N315            NRIASKNITKETHTSFLGAGVYDHYAPSVVDAMISRSEFYTAYTPYQPEISQGELQAIFE
    NCTC8325        NRIASKNITKETHTSFLGAGVYDHYAPSVVDAMISRSEFYTAYTPYQPEISQGELQAIFE
    Newman          NRIASKNITKETHTSFLGAGVYDHYAPSVVDAMISRSEFYTAYTPYQPEISQGELQAIFE
    USA300_FPR3757  NRIASKNITKETHTSFLGAGVYDHYAPSVVDAMISRSEFYTAYTPYQPEISQGELQAIFE
                    ************************************************************

    COL             FQTLICELTDMDVANSSMYDGMTSFAEACILAFSQTKKNKIVVSKGLHYQALQVLHTYAK
    N315            FQTLICELTDMDVANSSMYDGMTSFAEACILAFSQTKKNKIVVSKGLHYQALQVLHTYAK
    NCTC8325        FQTLICELTDMDVANSSMYDGMTSFAEACILAFSQTKKNKIVVSKGLHYQALQVLHTYAK
    Newman          FQTLICELTDMDVANSSMYDGMTSFAEACILAFSQTKKNKIVVSKGLHYQALQVLHTYAK
    USA300_FPR3757  FQTLICELTDMDVANSSMYDGMTSFAEACILAFSQTKKNKIVVSKGLHYQALQVLHTYAK
                    ************************************************************

    COL             TRKEFEVVEIDLDGTVTDLKKLEAAVDDETAAVAVQYPNFYGSIEDLKKIHSFIEDKKAL
    N315            TRKEFEVVEIDLDGTVTDLKKLEAAVDDETAAVAVQYPNFYGSIEDLEKIQSFIEDKKAL
    NCTC8325        TRKEFEVVEIDLDGTVTDLKKLEAAVDDETAAVAVQYPNFYGSIEDLEKIHSFIEDKKAL
    Newman          TRKEFEVVEIDLDGTVTDLKKLEAAVDDETAAVAVQYPNFYGSIEDLEKIHSFIEDKKAL
    USA300_FPR3757  TRKEFEVVEIDLDGTVTDLKKLEAAVDDETAAVAVQYPNFYGSIEDLEKIHSFIEDKKAL
                    ***********************************************:**:*********

    COL             FIVYANPLALGLLTPPGSFGADIVVGDTQPFGIPAQFGGPHCGYFATTKKLMRKVPGRLV
    N315            FIVYANPLALGLLTPPGSFGADIVVGDTQPFGIPAQFGGPHCGYFATTKKLMRKVPGRLV
    NCTC8325        FIVYANPLALGLLTPPGSFGADIVVGDTQPFGIPAQFGGPHCGYFATTKKLMRKVPGRLV
    Newman          FIVYANPLALGLLTPPGSFGADIVVGDTQPFGIPAQFGGPHCGYFATTKKLMRKVPGRLV
    USA300_FPR3757  FIVYANPLALGLLTPPGSFGADIVVGDTQPFGIPAQFGGPHCGYFATTKKLMRKVPGRLV
                    ************************************************************

    COL             GQTQDDEGNRGFVLTLQAREQHIRRDKATSNICSNQALNALASSIAMSALGKQGIYDIAV
    N315            GQTQDDEGNRGFVLTLQAREQHIRRDKATSNICSNQALNALASSIAMSALGKQGIYDIAV
    NCTC8325        GQTQDDEGNRGFVLTLQAREQHIRRDKATSNICSNQALNALASSIAMSALGKQGIYDIAV
    Newman          GQTQDDEGNRGFVLTLQAREQHIRRDKATSNICSNQALNALASSIAMSALGKQGIYDIAV
    USA300_FPR3757  GQTQDDEGNRGFVLTLQAREQHIRRDKATSNICSNQALNALASSIAMSALGKQGIYDIAV
                    ************************************************************

    COL             QNIEHANYAKQQFIKKGFEVLDGTSFNEFVVKFDKPIQQVNEELVKYNIIGGFDLGVVSD
    N315            QNIEHANYAKQQFIKKGFEVLDGTSFNEFVVKFDKPIQQVNEELVKYNIIGGFDLGVVSD
    NCTC8325        QNIEHANYAKQQFIKKGFEVLDGTSFNEFVVKFDKPIQQVNEELVKYNIIGGFDLGVVSD
    Newman          QNIEHANYAKQQFIKKGFEVLDGTSFNEFVVKFDKPIQQVNEELVKYNIIGGFDLGVVSD
    USA300_FPR3757  QNIEHANYAKQQFIKKGFEVLDGTSFNEFVVKFDKPIQQVNEELVKYNIIGGFDLGVVSD
                    ************************************************************

    COL             DFKNHMLIAVTELRTKDEIDTFVEKAGELND
    N315            DFKNHMLIAVTELRTKDEIDTFVEKAGELND
    NCTC8325        DFKNHMLIAVTELRTKDEIDTFVEKAGELND
    Newman          DFKNHMLIAVTELRTKDEIDTFVEKAGELND
    USA300_FPR3757  DFKNHMLIAVTELRTKDEIDTFVEKAGELND
                    *******************************