From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004122000
  • symbol?: comGB
  • description?: competence protein ComGB

      descriptions from strain specific annotations:

    • competence protein ComGB
    • competence protein ComGB-like protein
    • putative competence protein ComGB
    • Late competence protein ComGB, access of DNA to ComEA
    • bacterial type II secretion system F domain protein
    • ComG operon protein 2
    • DNA transport machinery protein comGB
    • DNA transport mechinery protein comGB
    • Late competence protein, putative
    • pseudogene
    • putative type II secretion system protein
    • type II secretion system protein
    • type II secretion system protein F domain protein
  • strand?: -
  • coordinates?: 4393930..4394850
  • synteny block?: BlockID0031520
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1501 (comGB)
    08BA02176:
    C248_1586
    11819-97:
    MS7_1560
    71193:
    ST398NM01_1608
    ECT-R 2:
    ECTR2_1394
    ED133:
    SAOV_1543
    ED98:
    SAAV_1535
    HO 5096 0412:
    SAEMRSA15_14630
    JH1:
    SaurJH1_1635
    JH9:
    SaurJH9_1601
    JKD6008:
    SAA6008_01513
    JKD6159:
    SAA6159_01478
    LGA251:
    SARLGA251_14490
    M013:
    M013TW_1558
    MRSA252:
    SAR1620
    MSHR1132:
    SAMSHR1132_13840
    MSSA476:
    SAS1481
    Mu3:
    SAHV_1530
    Mu50:
    SAV1543
    MW2:
    MW1495
    RF122:
    SAB1415c
    ST398:
    SAPIG1608
    T0131:
    SAT0131_01637
    TCH60:
    HMPREF0772_11598 (comGB)
    TW20:
    SATW20_15390
    USA300_TCH1516:
    USA300HOU_1545 (pulF)
    VC40:
    SAVC_06960

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKLQCINTFKLHSKKRQLSKAQQIDLLSNLCNLLKYGFTLYQSFQFLNLQMTYKNKQLGT
    N315            MKLQWINTFKLHSKKRQLSKAQQIDLLSNLCNLLKYGFTLYQSFQFLNLQMTYKNKQLGT
    NCTC8325        --------------------------------------------------MTYKNKQLGT
    Newman          MKLQCINTFKLHSKKRQLSKAQQIDLLSNLCNLLKYGFTLYQSFQFLNLQMTYKNKQLGT
    USA300_FPR3757  MKLQCINTFKLHSKKRQLSKAQQIDLLSNLCNLLKYGFTLYQSFQFLNLQMTYKNKQLGT
                                                                      **********

    COL             TILSEISNGAPCNQILSLIGYSDTIVMQVYLAERFGNIIDVLEETVNYMKVNRKSEQRLL
    N315            TILSEISNGAPCNQILSLIGYSDTIVMQVYLAERFGNIIDVLEETVNYMKVNRKSEQRLL
    NCTC8325        TILSEISNGAPCNQILSLIGYSDTIVMQVYLAERFGNIIDVLEETVNYMKVNRKSEQRLL
    Newman          TILSEISNGAPCNQILSLIGYSDTIVMQVYLAERFGNIIDVLEETVNYMKVNRKSEQRLL
    USA300_FPR3757  TILSEISNGAPCNQILSLIGYSDTIVMQVYLAERFGNIIDVLEETVNYMKVNRKSEQRLL
                    ************************************************************

    COL             KTLQYPLILVSIFIAMIIILNLTVIPQFQQLYTSMNIQLSSFQKTLSFFITSLPTIIVVM
    N315            KTLQYPLILVSIFIAMIIILNLTVIPQFQQLYTSMNIQLSSFQKTLSFFITSLPTIIVVM
    NCTC8325        KTLQYPLILVSIFIAMIIILNLTVIPQFQQLYTSMNIQLSSFQKTLSFFITSLPTIIVVM
    Newman          KTLQYPLILVSIFIAMIIILNLTVIPQFQQLYTSMNIQLSSFQKTLSFFITSLPTIIVVM
    USA300_FPR3757  KTLQYPLILVSIFIAMIIILNLTVIPQFQQLYTSMNIQLSSFQKTLSFFITSLPTIIVVM
                    ************************************************************

    COL             LIIVSMLAIIMKLIYNNLNMLNKINFVMKLPLISGYFQLFKTYFVTNELVLFYKNGITLQ
    N315            LIIVSMLAIIMKLIYNNLNMLNKINFVMKLPLISGYFQLFKTYFVTNELVLFYKNGITLQ
    NCTC8325        LIIVSMLAIIMKLIYNNLNMLNKINFVMKLPLISGYFQLFKTYFVTNELVLFYKNGITLQ
    Newman          LIIVSMLAIIMKLIYNNLNMLNKINFVMKLPLISGYFQLFKTYFVTNELVLFYKNGITLQ
    USA300_FPR3757  LIIVSMLAIIMKLIYNNLNMLNKINFVMKLPLISGYFQLFKTYFVTNELVLFYKNGITLQ
                    ************************************************************

    COL             SIVDVYINHSSDPFRQFLGKYLLTYSEMGYGLPQILEKLKCFKPQLIKFVLQGEKRGKLE
    N315            SIVDVYINHSSDPFRQFLGKYLLTYSEMGYGLPQILEKLKCFKPQLIKFVLQGEKRGKLE
    NCTC8325        SIVDVYINHSSDPFRQFLGKYLLTYSEMGYGLPQILEKLKCFKPQLIKFVLQGEKRGKLE
    Newman          SIVDVYINHSSDPFRQFLGKYLLTYSEMGYGLPQILEKLKCFKPQLIKFVLQGEKRGKLE
    USA300_FPR3757  SIVDVYINHSSDPFRQFLGKYLLTYSEMGYGLPQILEKLKCFKPQLIKFVLQGEKRGKLE
                    ************************************************************

    COL             VELKLYSQILVKQIEDKAIKQTQFLQPILFLILGLFIVAIYLVIMLPMFQMMQSIK
    N315            VELKLYSQILVKQIEDKAIKQTQFLQPILFLILGLFIVAIYLVIMLPMFQMMQSIK
    NCTC8325        VELKLYSQILVKQIEDKAIKQTQFLQPILFLILGLFIVAIYLVIMLPMFQMMQSIK
    Newman          VELKLYSQILVKQIEDKAIKQTQFLQPILFLILGLFIVAIYLVIMLPMFQMMQSIK
    USA300_FPR3757  VELKLYSQILVKQIEDKAIKQTQFLQPILFLILGLFIVAIYLVIMLPMFQMMQSIK
                    ********************************************************