From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004129000
  • symbol?:
  • description?: rhomboid family protein

      descriptions from strain specific annotations:

    • rhomboid family protein
    • rhomboid family peptidase
    • peptidase, rhomboid family protein
    • putative rhomboid family protein, truncated
    • Putative membrane peptidase, contains TPR repeat domain
    • membrane protein
    • integral membrane protein (Rhomboid family)
    • putative serine protease
  • strand?: -
  • coordinates?: 4398114..4399394
  • synteny block?: BlockID0031590
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1507
    08BA02176:
    C248_1592
    11819-97:
    MS7_1566
    71193:
    ST398NM01_1614
    ECT-R 2:
    ECTR2_1399
    ED133:
    SAOV_1549
    ED98:
    SAAV_1541
    HO 5096 0412:
    SAEMRSA15_14690
    JH1:
    SaurJH1_1641
    JH9:
    SaurJH9_1607
    JKD6008:
    SAA6008_01518 (gluP)
    JKD6159:
    SAA6159_01484 (gluP)
    LGA251:
    SARLGA251_14550
    M013:
    M013TW_1564
    MRSA252:
    SAR1626
    MSHR1132:
    SAMSHR1132_13890
    MSSA476:
    SAS1487
    Mu3:
    SAHV_1536
    Mu50:
    SAV1549
    MW2:
    MW1501
    RF122:
    SAB1421c
    ST398:
    SAPIG1614
    T0131:
    SAT0131_01643
    TCH60:
    HMPREF0772_11592
    TW20:
    SATW20_15450
    USA300_TCH1516:
    USA300HOU_1551
    VC40:
    SAVC_06986

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNIDKQFWKTIYYWIRYLNFDIVSREKDDQEIWLAHKRKKQVVIFKQHIKSTQEIRFDKA
    N315            MNIDKQFWKTIYYWIRYLNFDIVSREKDDQEIWLAHKRKKQVVIFKQHIKSTQEIRFDKA
    NCTC8325        MNIDKQFWKTIYYWIRYLNFDIVSREKDDQEIWLAHKRKKQVVIFKQHIKSTQEIRFDKA
    Newman          MNIDKQFWKTIYYWIRYLNFDIVSREKDDQEIWLAHKRKKQVVIFKQHIKSTQEIRFDKA
    USA300_FPR3757  MNIDKQFWKTIYYWIRYLNFDIVSREKDDQEIWLAHKRKKQVVIFKQHIKSTQEIRFDKA
                    ************************************************************

    COL             KVLEHKDEIANFISFEPQSFEFYYFTESEFSEEQLNEVSPIRIKFNVIRHTKDLIKHMPN
    N315            KVLEHKDEIANFISFEPQSFEFYYFTESEFSEEQLNEVSPIRIKFNVIRHTKDLIKHMPN
    NCTC8325        KVLEHKDEIANFISFEPQSFEFYYFTESEFSEEQLNEVSPIRIKFNVIRHTKDLIKHMPN
    Newman          KVLEHKDEIANFISFEPQSFEFYYFTESEFSEEQLNEVSPIRIKFNVIRHTKDLIKHMPN
    USA300_FPR3757  KVLEHKDEIANFISFEPQSFEFYYFTESEFSEEQLNEVSPIRIKFNVIRHTKDLIKHMPN
                    ************************************************************

    COL             IFLARLISEDNDKKTYMFYKRKVLTDNFLDKYMQKFSPATYTIIFVNVLIWLCMILYLNN
    N315            IFLARLISEDNDKKTYMFYKRKVLTDNFLDKYMQKFSPATYTIIFVNVLIWLCMILYLNN
    NCTC8325        IFLARLISEDNDKKTYMFYKRKVLTDNFLDKYMQKFSPATYTIIFVNVLIWLCMILYLNN
    Newman          IFLARLISEDNDKKTYMFYKRKVLTDNFLDKYMQKFSPATYTIIFVNVLIWLCMILYLNN
    USA300_FPR3757  IFLARLISEDNDKKTYMFYKRKVLTDNFLDKYMQKFSPATYTIIFVNVLIWLCMILYLNN
                    ************************************************************

    COL             FSDVKLLDVGGLVHFNVVHGEWYRIVTSMFLHFSFEHILMNMLSLFIFGKIVEAIIGSWR
    N315            FSDVKLLDVGGLVHFNVVHGEWYRIVTSMFLHFSFEHILMNMLSLFIFGKIVEAIIGSWR
    NCTC8325        FSDVKLLDVGGLVHFNVVHGEWYRIVTSMFLHFSFEHILMNMLSLFIFGKIVEAIIGSWR
    Newman          FSDVKLLDVGGLVHFNVVHGEWYRIVTSMFLHFSFEHILMNMLSLFIFGKIVEAIIGSWR
    USA300_FPR3757  FSDVKLLDVGGLVHFNVVHGEWYRIVTSMFLHFSFEHILMNMLSLFIFGKIVEAIIGSWR
                    ************************************************************

    COL             MLTVYFIAGLFGNFVSLSFNTTTISVGASGAIFGLIGSIFAMMYVSKTFNKKMLGQLLIA
    N315            MLTVYFIAGLFGNFVSLSFNTTTISVGASGAIFGLIGSIFAMMYVSKTFNKKMLGQLLIA
    NCTC8325        MLTVYFIAGLFGNFVSLSFNTTTISVGASGAIFGLIGSIFAMMYVSKTFNKKMLGQLLIA
    Newman          MLTVYFIAGLFGNFVSLSFNTTTISVGASGAIFGLIGSIFAMMYVSKTFNKKMLGQLLIA
    USA300_FPR3757  MLTVYFIAGLFGNFVSLSFNTTTISVGASGAIFGLIGSIFAMMYVSKTFNKKMLGQLLIA
                    ************************************************************

    COL             LVILVGVSLFMSNINIVAHIGGFIGGLLITLIGYYYKVNRNIFWILLIGMLVIFIALQIR
    N315            LVILVGVSLFMSNINIVAHIGGFIGGLLITLIGYYYKVNRNIFWILLIGMLVIFIALQIR
    NCTC8325        LVILVGVSLFMSNINIVAHIGGFIGGLLITLIGYYYKVNRNIFWILLIGMLVIFIALQIR
    Newman          LVILVGVSLFMSNINIVAHIGGFIGGLLITLIGYYYKVNRNIFWILLIGMLVIFIALQIR
    USA300_FPR3757  LVILVGVSLFMSNINIVAHIGGFIGGLLITLIGYYYKVNRNIFWILLIGMLVIFIALQIR
                    ************************************************************

    COL             IFTIKEDNIYNKLIKDDMTSGNYDNAQNIVKQTINKNYADDQTYYLSGMIMATINSKSEG
    N315            IFTIKEDNIYNKLIKDDMTSGNYDNAQNIVKQTINKNYADDQTYYLSGMIMATINSKSEG
    NCTC8325        IFTIKEDNIYNKLIKDDMTSGNYDNAQNIAKQTINKNYADDQTYYLSGMIMATINSKSEG
    Newman          IFTIKEDNIYNKLIKDDMTSGNYDNAQNIVKQTINKNYADDQTYYLSGMIMATINSKSEG
    USA300_FPR3757  IFTIKEDNIYNKLIKDDMTSGNYDNAQNIVKQTINKNYADDQTYYLSGMIMATINSKSEG
                    *****************************.******************************

    COL             MTEWERGLRMFPKSGLLNFELAIANRSLNDDEKALKYVRKALNADPKNTDYINLEKELTK
    N315            MTEWERGLRMFPKSGLLNFELAIANRSLNDDEKALKYVRKALNADPKNTDYINLEKELTK
    NCTC8325        MTEWERGLRMFPKSGLLNFELAIANRSLNDDEKALKYVRKALNADPKNTDYINLEKELTK
    Newman          MTEWERGLRMFPKSGLLNFELAIANRSLNDDEKALKYVRKALNADPKNTDYINLEKELTK
    USA300_FPR3757  MTEWERGLRMFPKSGLLNFELAIANRSLNDDEKALKYVRKALNADPKNTDYINLEKELTK
                    ************************************************************

    COL             SNESKNK
    N315            SNESKNK
    NCTC8325        SNESKNK
    Newman          SNESKNK
    USA300_FPR3757  SNESKNK
                    *******