From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004145000
  • symbol?: ccpN
  • description?: CBS domain-containing protein

      descriptions from strain specific annotations:

    • CBS domain-containing protein
    • CBS domain protein
    • Transcriptional repressor ccpN
    • putative transcriptional repressor ccpN
    • pseudogene
    • putative DNA-binding protein
  • strand?: -
  • coordinates?: 4414210..4414701
  • synteny block?: BlockID0031750
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1522
    08BA02176:
    C248_1607
    11819-97:
    MS7_1581 (ccpN)
    71193:
    ST398NM01_1629
    ECT-R 2:
    ECTR2_1414
    ED133:
    SAOV_1564
    ED98:
    SAAV_1556
    HO 5096 0412:
    SAEMRSA15_14840
    JH1:
    SaurJH1_1656
    JH9:
    SaurJH9_1622
    JKD6008:
    SAA6008_01533
    JKD6159:
    SAA6159_01499
    LGA251:
    SARLGA251_14700 (ccpN)
    M013:
    M013TW_1579
    MRSA252:
    SAR1641
    MSHR1132:
    SAMSHR1132_14040
    MSSA476:
    SAS1502
    Mu3:
    SAHV_1551
    Mu50:
    SAV1564
    MW2:
    MW1516
    RF122:
    SAB1436c
    ST398:
    SAPIG1629
    T0131:
    SAT0131_01659
    TCH60:
    HMPREF0772_11576
    TW20:
    SATW20_15600 (ccpN)
    USA300_TCH1516:
    VC40:
    SAVC_07070

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ----------------------------MNLTRATLRPDLAILTMSGFLEARPRVGYYYS
    N315            MELSQRQERIIEIVKTKGPITGEQIADKLNLTRATLRPDLAILTMSGFLEARPRVGYYYS
    NCTC8325        ----------------------------MNLTRATLRPDLAILTMSGFLEARPRVGYYYS
    Newman          ----------------------------MNLTRATLRPDLAILTMSGFLEARPRVGYYYS
    USA300_FPR3757  ----------------------------MNLTRATLRPDLAILTMSGFLEARPRVGYYYS
                                                :*******************************

    COL             GKSKGKFFNEKLRQFEVKDYMSQPVVLRENTTVYDAICTIFLEDVSTLFIINEDNDFVGV
    N315            GKSKGKFFNEKLRQFEVKDYMSQPVVLRENTTVYDAICTIFLEDVSTLFIINEDNDFVGV
    NCTC8325        GKSKGKFFNEKLRQFEVKDYMSQPVVLRENTTVYDAICTIFLEDVSTLFIINEDNDFVGV
    Newman          GKSKGKFFNEKLRQFEVKDYMSQPVVLRENTTVYDAICTIFLEDVSTLFIINEDNDFVGV
    USA300_FPR3757  GKSKGKFFNEKLRQFEVKDYMSQPVVLRENTTVYDAICTIFLEDVSTLFIINEDNDFVGV
                    ************************************************************

    COL             CSRKDLLRASMIGADIHKVPISVNMTRMPNVTYLEESELVIYAADRMIEKEIDSIPIVRK
    N315            CSRKDLLRASMIGADIHTVPISVNMTRMPNVTYLEESELVIYAADRMIEKEIDSIPIVRK
    NCTC8325        CSRKDLLRASMIGADIHKVPISVNMTRMPNVTYLEESELVIYAADRMIEKEIDSIPIVRK
    Newman          CSRKDLLRASMIGADIHKVPISVNMTRMPNVTYLEESELVIYAADRMIEKEIDSIPIVRK
    USA300_FPR3757  CSRKDLLRASMIGADIHKVPISVNMTRMPNVTYLEESELVIYAADRMIEKEIDSIPIVRK
                    *****************.******************************************

    COL             KDNQKYEVIGRISKTTIAKLLVALYKE
    N315            KDNQKYEVIGRISKTTIAKLLVALYKE
    NCTC8325        KDNQKYEVIGRISKTTIAKLLVALYKE
    Newman          KDNQKYEVIGRISKTTIAKLLVALYKE
    USA300_FPR3757  KDNQKYEVIGRISKTTIAKLLVALYKE
                    ***************************