From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004148000
  • symbol?: era
  • description?: GTP-binding protein Era

      descriptions from strain specific annotations:

    • GTP-binding protein Era
    • GTP-binding protein era -like protein
    • GTPase Era
    • putative GTP-binding protein
    • pseudogene
  • strand?: -
  • coordinates?: 4417523..4418422
  • synteny block?: BlockID0031780
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1624 (era)
    N315:
    SA1396 (era)
    NCTC8325:
    Newman:
    NWMN_1470 (era)
    USA300_FPR3757:
    04-02981:
    SA2981_1525 (bex)
    08BA02176:
    C248_1610 (era)
    11819-97:
    MS7_1584 (era)
    71193:
    ST398NM01_1632
    ECT-R 2:
    ECTR2_1417 (era)
    ED133:
    SAOV_1567 (era)
    ED98:
    SAAV_1559 (era)
    HO 5096 0412:
    SAEMRSA15_14870 (era)
    JH1:
    SaurJH1_1659 (era)
    JH9:
    SaurJH9_1625 (era)
    JKD6008:
    SAA6008_01537 (era)
    JKD6159:
    SAA6159_01502 (era)
    LGA251:
    SARLGA251_14730 (era)
    M013:
    M013TW_1582
    MRSA252:
    SAR1644 (era)
    MSHR1132:
    SAMSHR1132_14070
    MSSA476:
    SAS1505 (era)
    Mu3:
    SAHV_1554 (era)
    Mu50:
    SAV1567 (era)
    MW2:
    MW1519 (era)
    RF122:
    SAB1439c (era)
    ST398:
    SAPIG1632 (era)
    T0131:
    SAT0131_01662
    TCH60:
    HMPREF0772_11573 (era)
    TW20:
    SATW20_15630 (era)
    USA300_TCH1516:
    USA300HOU_1568 (era)
    VC40:
    SAVC_07085 (era)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTEHKSGFVSIIGRPNVGKSTFVNRVIGHKIAIMSDKAQTTRNKIQGVMTRDDAQIIFID
    N315            MTEHKSGFVSIIGRPNVGKSTFVNRVIGHKIAIMSDKAQTTRNKIQGVMTRDDAQIIFID
    NCTC8325        MTEHKSGFVSIIGRPNVGKSTFVNRVIGHKIAIMSDKAQTTRNKIQGVMTRDDAQIIFID
    Newman          MTEHKSGFVSIIGRPNVGKSTFVNRVIGHKIAIMSDKAQTTRNKIQGVMTRDDAQIIFID
    USA300_FPR3757  MTEHKSGFVSIIGRPNVGKSTFVNRVIGHKIAIMSDKAQTTRNKIQGVMTRDDAQIIFID
                    ************************************************************

    COL             TPGIHKPKHKLGDYMMKVAKNTLSEIDAIMFMVNANEEIGRGDEYIIEMLKNVKTPVFLV
    N315            TPGIHKPKHKLGDYMMKVAKNTLSEIDAIMFMVNANEEIGRGDEYIIEMLKNVKTPVFLV
    NCTC8325        TPGIHKPKHKLGDYMMKVAKNTLSEIDAIMFMVNANEEIGRGDEYIIEMLKNVKTPVFLV
    Newman          TPGIHKPKHKLGDYMMKVAKNTLSEIDAIMFMVNANEEIGRGDEYIIEMLKNVKTPVFLV
    USA300_FPR3757  TPGIHKPKHKLGDYMMKVAKNTLSEIDAIMFMVNANEEIGRGDEYIIEMLKNVKTPVFLV
                    ************************************************************

    COL             LNKIDLVHPDELMPKIEEYQSYMDFTEIVPISALEGLNVDHFIDVLKTYLPEGPKYYPDD
    N315            LNKIDLVHPDELMPKIEEYQSYMDFTEIVPISALEGLNVDHFIDVLKTYLPEGPKYYPDD
    NCTC8325        LNKIDLVHPDELMPKIEEYQSYMDFTEIVPISALEGLNVDHFIDVLKTYLPEGPKYYPDD
    Newman          LNKIDLVHPDELMPKIEEYQSYMDFTEIVPISALEGLNVDHFIDVLKTYLPEGPKYYPDD
    USA300_FPR3757  LNKIDLVHPDELMPKIEEYQSYMDFTEIVPISALEGLNVDHFIDVLKTYLPEGPKYYPDD
                    ************************************************************

    COL             QISDHPEQFVVGEIIREKILHLTSEEIPHAIGVNVDRMVKESEDRVHIEATIYVERDSQK
    N315            QISDHPEQFVVGEIIREKILHLTSEEIPHAIGVNVDRMVKESEDRVHIEATIYVERDSQK
    NCTC8325        QISDHPEQFVVGEIIREKILHLTSEEIPHAIGVNVDRMVKESEDRVHIEATIYVERGSQK
    Newman          QISDHPEQFVVGEIIREKILHLTSEEIPHAIGVNVDRMVKESEDRVHIEATIYVERDSQK
    USA300_FPR3757  QISDHPEQFVVGEIIREKILHLTSEEIPHAIGVNVDRMVKESEDRVHIEATIYVERDSQK
                    ********************************************************.***

    COL             GIVIGKGGKKLKEVGKRARRDIEMLLGSKVYLELWVKVQRDWRNKVNFIRQIGYVEDQD
    N315            GIVIGKGGKKLKEVGKRARRDIEMLLGSKVYLELWVKVQRDWRNKVNFIRQIGYVEDQD
    NCTC8325        GIVIGKGGKKLKEVGKRARRDIEMLLGSKVYLELWVKVQRDWRNKVNFIRQIGYVEDQD
    Newman          GIVIGKGGKKLKEVGKRARRDIEMLLGSKVYLELWVKVQRDWRNKVNFIRQIGYVEDQD
    USA300_FPR3757  GIVIGKGGKKLKEVGKRARRDIEMLLGSKVYLELWVKVQRDWRNKVNFIRQIGYVEDQD
                    ***********************************************************