From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004153000
  • symbol?: phoH
  • description?: phosphate starvation-induced protein phoH-like protein

      descriptions from strain specific annotations:

    • phosphate starvation-induced protein phoH-like protein
    • PhoH family protein
    • phosphate starvation-induced protein phoH homologue
    • Phosphate starvation-inducible protein PhoH, predicted ATPase
    • phoH-like family protein
    • PhoH-like protein
    • PhoH family phosphate starvation-induced protein
    • phosphate starvation-induced protein, PhoH-like protein
    • phosphate starvation-inducible protein PhoH
    • Phosphate starvation-inducible ATPase
    • Phoh
  • strand?: -
  • coordinates?: 4419653..4420573
  • synteny block?: BlockID0031830
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1400 (phoH)
    NCTC8325:
    Newman:
    NWMN_1474 (phoH)
    USA300_FPR3757:
    04-02981:
    SA2981_1529 (phoH)
    08BA02176:
    C248_1614
    11819-97:
    MS7_1588
    71193:
    ST398NM01_1636
    ECT-R 2:
    ECTR2_1421
    ED133:
    SAOV_1571
    ED98:
    SAAV_1563
    HO 5096 0412:
    SAEMRSA15_14910
    JH1:
    SaurJH1_1663
    JH9:
    SaurJH9_1629
    JKD6008:
    SAA6008_01541 (phoH)
    JKD6159:
    SAA6159_01506 (phoH)
    LGA251:
    SARLGA251_14770
    M013:
    M013TW_1586
    MRSA252:
    SAR1648
    MSHR1132:
    SAMSHR1132_14110
    MSSA476:
    SAS1509
    Mu3:
    SAHV_1558 (phoH)
    Mu50:
    SAV1571 (phoH)
    MW2:
    MW1523 (phoH)
    RF122:
    SAB1443c
    ST398:
    SAPIG1636
    T0131:
    SAT0131_01667 (hslO)
    TCH60:
    HMPREF0772_11569 (phoH)
    TW20:
    SATW20_15670
    USA300_TCH1516:
    USA300HOU_1572 (phoH)
    VC40:
    SAVC_07105

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---------MNQSQALIGNNDEHLKAIEESFDVVIHARGQEVAVKGTKIENVEKAESVLI
    N315            MPGIIQIDDMNQSQALIGNNDEHLKAIEESFDVVIHARGQEVAVKGTKIENVEKAESVLI
    NCTC8325        MPGIIQIDDMNQSQALIGNNDEHLKAIEESFDVVIHARGQEVAVKGTKIENVEKAESVLI
    Newman          MPGIIQIDDMNQSQALIGNNDEHLKAIEESFDVVIHARGQEVAVKGTKIENVEKAESVLI
    USA300_FPR3757  MPGIIQIDDMNQSQALIGNNDEHLKAIEESFDVVIHARGQEVAVKGTKIENVEKAESVLI
                             ***************************************************

    COL             NLLKVIDLGNNITIKDVEAAIKMAHNNTIQHLLDLYDEEITKDAFGKTIRAKTMGQRIYV
    N315            NLLKVIDLGNNITIKDVEAAIKMAHNNTIQHLLDLYDEEITKDAFGKTIRAKTMGQRIYV
    NCTC8325        NLLKVIDLGNNITIKDVEAAIKMAHNNTIQHLLDLYDEEITKDAFGKTIRAKTMGQRIYV
    Newman          NLLKVIDLGNNITIKDVEAAIKMAHNNTIQHLLDLYDEEITKDAFGKTIRAKTMGQRIYV
    USA300_FPR3757  NLLKVIDLGNNITIKDVEAAIKMAHNNTIQHLLDLYDEEITKDAFGKTIRAKTMGQRIYV
                    ************************************************************

    COL             NAMKNNDLVFGIGPAGTGKTFLAVVYAAKQLRKGAVKRIVLTRPAVEAGESLGFLPGDLK
    N315            NAMKNNDLVFGIGPAGTGKTFLAVVYAAKQLRKGAVKRIVLTRPAVEAGESLGFLPGDLK
    NCTC8325        NAMKNNDLVFGIGPAGTGKTFLAVVYAAKQLRKGAVKRIVLTRPAVEAGESLGFLPGDLK
    Newman          NAMKNNDLVFGIGPAGTGKTFLAVVYAAKQLRKGAVKRIVLTRPAVEAGESLGFLPGDLK
    USA300_FPR3757  NAMKNNDLVFGIGPAGTGKTFLAVVYAAKQLRKGAVKRIVLTRPAVEAGESLGFLPGDLK
                    ************************************************************

    COL             EKVDPYLRPLYDGLYTVLGREQTERFIERGIIEIAPLAYMRGRTLEDAFVILDEAQNTTH
    N315            EKVDPYLRPLYDGLYTVLGREQTERFIERGIIEIAPLAYMRGRTLEDAFVILDEAQNTTH
    NCTC8325        EKVDPYLRPLYDGLYTVLGREQTERFIERGIIEIAPLAYMRGRTLEDAFVILDEAQNTTH
    Newman          EKVDPYLRPLYDGLYTVLGREQTERFIERGIIEIAPLAYMRGRTLEDAFVILDEAQNTTH
    USA300_FPR3757  EKVDPYLRPLYDGLYTVLGREQTERFIERGIIEIAPLAYMRGRTLEDAFVILDEAQNTTH
                    ************************************************************

    COL             AQMKMFLTRLGFGSKMVVTGDQTQIDLPKGVKSGLKEAVSRLHNVKGISILKLDQSDVVR
    N315            AQMKMFLTRLGFGSKMVVTGDQTQIDLPKGVKSGLKEAVSRLHNVKGISILKLDQSDVVR
    NCTC8325        AQMKMFLTRLGFGSKMVVTGDQTQIDLPKGVKSGLKEAVSRLHNVKGISILKLDQSDVVR
    Newman          AQMKMFLTRLGFGSKMVVTGDQTQIDLPKGVKSGLKEAVSRLHNVKGISILKLDQSDVVR
    USA300_FPR3757  AQMKMFLTRLGFGSKMVVTGDQTQIDLPKGVKSGLKEAVSRLHNVKGISILKLDQSDVVR
                    ************************************************************

    COL             HPLVSKIIEHYEGEN
    N315            HPLVSKIIEHYEGEN
    NCTC8325        HPLVSKIIEHYEGEN
    Newman          HPLVSKIIEHYEGEN
    USA300_FPR3757  HPLVSKIIEHYEGEN
                    ***************