From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004210000
  • symbol?:
  • description?: O-methyltransferase

      descriptions from strain specific annotations:

    • O-methyltransferase
    • O-methyltransferase family protein
    • caffeoyl-CoA O-methyltransferase
    • methyltransferase domain protein
    • putative O-methyltransferase
  • strand?: -
  • coordinates?: 4462742..4463380
  • synteny block?: BlockID0032380
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1572
    08BA02176:
    C248_1656
    11819-97:
    MS7_1630
    71193:
    ST398NM01_1678
    ECT-R 2:
    ECTR2_1463
    ED133:
    SAOV_1612
    ED98:
    SAAV_1606
    HO 5096 0412:
    SAEMRSA15_15320
    JH1:
    SaurJH1_1705
    JH9:
    SaurJH9_1671
    JKD6008:
    SAA6008_01584
    JKD6159:
    SAA6159_01547
    LGA251:
    SARLGA251_15170
    M013:
    M013TW_1633
    MRSA252:
    SAR1693
    MSHR1132:
    SAMSHR1132_14510
    MSSA476:
    SAS1550
    Mu3:
    SAHV_1601
    Mu50:
    SAV1614
    MW2:
    MW1564
    RF122:
    SAB1485c
    ST398:
    SAPIG1678
    T0131:
    SAT0131_01711
    TCH60:
    HMPREF0772_11527
    TW20:
    SATW20_16090
    USA300_TCH1516:
    USA300HOU_1614
    VC40:
    SAVC_07320

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDDLNKKYLIDLHQHQNSSIEVLREFAEVNEVPIVDRLTLDLIKQLIRMNNVKNILEIGT
    N315            MDDLNKKYLIDLHQHQNSSIEVLREFAEGNEVPIVDRLTLDLIKQLIRMNNVKNILEIGT
    NCTC8325        MDDLNKKYLIDLHQHQNSSIEVLREFAEVNEVPIVDRLTLDLIKQLIRMNNVKNILEIGT
    Newman          MDDLNKKYLIDLHQHQNSSIEVLREFAEVNEVPIVDRLTLDLIKQLIRMNNVKNILEIGT
    USA300_FPR3757  MDDLNKKYLIDLHQHQNSSIEVLREFAEVNEVPIVDRLTLDLIKQLIRMNNVKNILEIGT
                    **************************** *******************************

    COL             AIGYSSMQFASISDDIHVTTIERNETMIQYAKQNLATYHFENQVRIIEGNALEQFENVND
    N315            AIGYSSMQFASISDDIHVTTIERNETMIQYAKQNLATYHFENQVRIIEGNALEQFENVND
    NCTC8325        AIGYSSMQFASISDDIHVTTIERNETMIQYAKQNLATYHFENQVRIIEGNALEQFENVND
    Newman          AIGYSSMQFASISDDIHVTTIERNETMIQYAKQNLATYHFENQVRIIEGNALEQFENVND
    USA300_FPR3757  AIGYSSMQFASISDDIHVTTIERNETMIQYAKQNLATYHFENQVRIIEGNALEQFENVND
                    ************************************************************

    COL             KVYDMIFIDAAKAQSKKFFEIYTPLLKHQGLVITDNVLYHGFVSDIGIVRSRNVRQMVKK
    N315            KVYDMIFIDAAKAQSKKFFEIYTPLLKHQGLVITDNVLYHGFVSDIGIVRSRNVRQMVKK
    NCTC8325        KVYDMIFIDAAKAQSKKFFEIYTPLLKHQGLVITDNVLYHGFVSDIGIVRSRNVRQMVKK
    Newman          KVYDMIFIDAAKAQSKKFFEIYTPLLKHQGLVITDNVLYHGFVSDIGIVRSRNVRQMVKK
    USA300_FPR3757  KVYDMIFIDAAKAQSKKFFEIYTPLLKHQGLVITDNVLYHGFVSDIGIVRSRNVRQMVKK
                    ************************************************************

    COL             VQDYNEWLIKQPGYTTNFLNIDDGLAISIKGE
    N315            VQDYNEWLIKQPGYTTNFLNIDDGLAISIKGE
    NCTC8325        VQDYNEWLIKQPGYTTNFLNIDDGLAISIKGE
    Newman          VQDYNEWLIKQPGYTTNFLNIDDGLAISIKGE
    USA300_FPR3757  VQDYNEWLIKQPGYTTNFLNIDDGLAISIKGE
                    ********************************