From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004218000
  • symbol?:
  • description?: TPR domain-containing protein

      descriptions from strain specific annotations:

    • TPR domain-containing protein
    • Tetratricopeptide repeat (TPR) family protein
    • anaphase-promoting complex, cyclosome, subunit 3 family protein
    • tetratricopeptide domain-containing protein
    • Tetratricopeptide (TPR) domain protein
    • TPR domain protein
    • O-linked GlcNAc transferase
    • tetratricopeptide repeat family protein
  • strand?: -
  • coordinates?: 4470339..4471007
  • synteny block?: BlockID0032460
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1578
    08BA02176:
    C248_1662
    11819-97:
    MS7_1636
    71193:
    ST398NM01_1684
    ECT-R 2:
    ECTR2_1469
    ED133:
    SAOV_1618
    ED98:
    SAAV_1613
    HO 5096 0412:
    SAEMRSA15_15380
    JH1:
    SaurJH1_1711
    JH9:
    SaurJH9_1677
    JKD6008:
    SAA6008_01590
    JKD6159:
    SAA6159_01553
    LGA251:
    SARLGA251_15230
    M013:
    M013TW_1641
    MRSA252:
    SAR1699
    MSHR1132:
    SAMSHR1132_14570
    MSSA476:
    SAS1556
    Mu3:
    SAHV_1607
    Mu50:
    SAV1620
    MW2:
    MW1570
    RF122:
    SAB1491c
    ST398:
    SAPIG1684
    T0131:
    SAT0131_01717
    TCH60:
    HMPREF0772_11521
    TW20:
    SATW20_16150
    USA300_TCH1516:
    USA300HOU_1620
    VC40:
    SAVC_07350

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIDQQTIYQYIQNGKIEEALQALFGNIEENPTIIENYINAGIVLADANEIEKAERFFQKA
    N315            MIDQQTIYQYIQNGKIEEALQALFGNIEEDPTIIENYINAGIVLADANEIEKAERFFQKA
    NCTC8325        MIDQQTIYQYIQNGKIEEALQALFGNIEENPTIIENYINAGIVLADANEIEKAERFFQKA
    Newman          MIDQQTIYQYIQNGKIEEALQALFGNIEENPTIIENYINAGIVLADANEIEKAERFFQKA
    USA300_FPR3757  MIDQQTIYQYIQNGKIEEALQALFGNIEENPTIIENYINAGIVLADANEIEKAERFFQKA
                    *****************************:******************************

    COL             LTIDPKNGVVFFNLANVYYNQQRYQEAIKLYQQALQTEIEQVDCNYMIGMAFNQLESFKL
    N315            LTIDPKNGVVFYNLANVYYNQQRYQEAIKLYQQALQTEIEQVDCNYMIGMAFNQLESFKL
    NCTC8325        LTIDPKNGVVFFNLANVYYNQQRYQEAIKLYQQALQTEIEQVDCNYMIGMAFNQLESFKL
    Newman          LTIDPKNGVVFFNLANVYYNQQRYQEAIKLYQQALQTEIEQVDCNYMIGMAFNQLESFKL
    USA300_FPR3757  LTIDPKNGVVFFNLANVYYNQQRYQEAIKLYQQALQTEIEQVDCNYMIGMAFNQLESFKL
                    ***********:************************************************

    COL             ALPYLMTAAELDKDKDAEVQFQYGLVLCQLEMFNEAITQLKHVLTIDKNHVDARYNLGLA
    N315            ALPYLMTAAELDKDKDAEVQFQYGLVLCQLEMFNEAITQLKHVLTIDKNHVDARYNLGLA
    NCTC8325        ALPYLMTAAELDKDKDAEVQFQYGLVLCQLEMFNEAITQLKHVLTIDKNHVDARYNLGLA
    Newman          ALPYLMTAAELDKDKDAEVQFQYGLVLCQLEMFNEAITQLKHVLTIDKNHVDARYNLGLA
    USA300_FPR3757  ALPYLMTAAELDKDKDAEVQFQYGLVLCQLEMFNEAITQLKHVLTIDKNHVDARYNLGLA
                    ************************************************************

    COL             LFMKNEDIDEAITHFKEAVTIDPKHLLSQHALKTFTKMKEEE
    N315            LFMKNEDIDEAITHFKEAVTIDPKHLLSQHALKTFTKMKEEE
    NCTC8325        LFMKNEDIDEAITHFKEAVTIDPKHLLSQHALKTFTKMKEEE
    Newman          LFMKNEDIDEAITHFKEAVTIDPKHLLSQHALKTFTKMKEEE
    USA300_FPR3757  LFMKNEDIDEAITHFKEAVTIDPKHLLSQHALKTFTKMKEEE
                    ******************************************