Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004316000
  • symbol?: phoR
  • description?: alkaline phosphatase synthesis sensor protein

      descriptions from strain specific annotations:

    • alkaline phosphatase synthesis sensor protein
    • multi-sensor signal transduction histidine kinase
    • PAS sensor protein
    • sensory box histidine kinase PhoR
    • Phosphate regulon sensor protein PhoR
    • sensory box protein
    • sensor histidine kinase
    • alkaline phosphatase synthesis sensor protein PhoR
    • phosphate regulon sensor histidine kinase protein PhoR
    • PhoR protein
  • strand?: -
  • coordinates?: 4557667..4559307
  • synteny block?: BlockID0033400
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1515 (phoR)
    NCTC8325:
    Newman:
    NWMN_1585 (phoR)
    USA300_FPR3757:
    04-02981:
    SA2981_1651 (phoR)
    08BA02176:
    C248_1734 (phoR)
    11819-97:
    MS7_1699
    71193:
    ST398NM01_1746
    ECT-R 2:
    ECTR2_1532
    ED133:
    SAOV_1680 (phoR)
    ED98:
    SAAV_1682
    HO 5096 0412:
    SAEMRSA15_16020 (phoR)
    JH1:
    SaurJH1_1783
    JH9:
    SaurJH9_1749
    JKD6008:
    SAA6008_01659 (phoR)
    JKD6159:
    SAA6159_01616 (phoR)
    LGA251:
    SARLGA251_15840 (phoR)
    M013:
    M013TW_1705
    MRSA252:
    SAR1771 (phoR)
    MSHR1132:
    SAMSHR1132_15430
    MSSA476:
    SAS1620
    Mu3:
    SAHV_1678 (phoR)
    Mu50:
    SAV1692 (phoR)
    MW2:
    MW1636 (phoR)
    RF122:
    SAB1551c (phoR)
    ST398:
    SAPIG1746
    T0131:
    SAT0131_01794 (sarA)
    TCH60:
    HMPREF0772_11459 (phoR)
    TW20:
    SATW20_16820 (phoR)
    USA300_TCH1516:
    USA300HOU_1679
    VC40:
    SAVC_07665 (phoR)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MMKFHHRLMLLISSILIISFVTLGIIIHASITYVLSEKHEQALATDARSYIYLVQDNEID
    N315            MMKFHHRLMLLISSILIISFVTLGIIIHASITYVLSEKHEQALATDARSYIYLVQDNEID
    NCTC8325        -MKFHHRLMLLISSILIISFVTLGIIIHASITYVLSEKHEQALATDARSYIYLVQDNEID
    Newman          MMKFHHRLMLLISSILIISFVTLGIIIHASITYVLSEKHEQALATDARSYIYLVQDNEID
    USA300_FPR3757  -MKFHHRLMLLISSILIISFVTLGIIIHASITYVLSEKHEQALATDARSYIYLVQDNEID
                     ***********************************************************

    COL             KVKKIVKQQNIDLLITKHDKKVFSSGKLKAIPNSDSYIQKRDVFIFNKKVNGYHVWIKGY
    N315            KVKEIVKQQNIDLLITKHDKKVFSSGKLKAIPNSDSYIQKRDVFIFNKKVNGYHVWIKGY
    NCTC8325        KVKKIVKQQNIDLLITKHDKKVFSSGKLKAIPNSDSYIQKRDVFIFNKKVNGYHVWIKGY
    Newman          KVKKIVKQQNIDLLITKHDKKVFSSGKLKAIPNSDSYIQKRDVFIFNKKVNGYHVWIKGY
    USA300_FPR3757  KVKKIVKQQNIDLLITKHDKKVFSSGKLKAIPNSDSYIQKRDVFIFNKKVNGYHVWIKGY
                    ***:********************************************************

    COL             NNDITEMHWTLWKYLILTCLVVLICLYFASRSFKRTLIRPIQEVTYATQLLANGYYHIRV
    N315            NNDITEMHWTLWKYLILTCLVVLICLYFASRSFKRTLIRPIQEVTYATQLLANGYYHIRV
    NCTC8325        NNDITEMHWTLWKYLILTCLVVLICLYFASRSFKRTLIRPIQEVTYATQLLANGYYHIRV
    Newman          NNDITEMHWTLWKYLILTCLVVLICLYFASRSFKRTLIRPIQEVTYATQLLANGYYHIRV
    USA300_FPR3757  NNDITEMHWTLWKYLILTCLVVLICLYFASRSFKRTLIRPIQEVTYATQLLANGYYHIRV
                    ************************************************************

    COL             PESNVVETKALFVSTNDLARRLQKLNNEQKIQSNRLKTTIENIPSAILMIDRNGKIVVAN
    N315            PESNVVETKALFVSTNDLARRLQKLNNEQKIQSNRLKTTIENIPSAILMIDRNGKIVVAN
    NCTC8325        PESNVVETKALFVSTNDLARRLQKLNNEQKIQSNRLKTTIENIPSAILMIDRNGKIVVAN
    Newman          PESNVVETKALFVSTNDLARRLQKLNNEQKIQSNRLKTTIENIPSAILMIDRNGKIVVAN
    USA300_FPR3757  PESNVVETKALFVSTNDLARRLQKLNNEQKIQSNRLKTTIENIPSAILMIDRNGKIVVAN
                    ************************************************************

    COL             KAYYEQFNISHNIEQVGYHGYVNTEIEQLILESFKVEKPIYEQLEVAINQVHAKYFDISC
    N315            KAYYEQFNISHNIEQVGYHGYVNTEIEQLILESFKVEKPIYEQLEVAINQVHAKYFDISC
    NCTC8325        KAYYEQFNISHNIEQVGYHGYVNTEIEQLILESFKVEKPIYEQLEVAINQVHAKYFDISC
    Newman          KAYYEQFNISHNIEQVGYHGYVNTEIEQLILESFKVEKPIYEQLEVAINQVHAKYFDISC
    USA300_FPR3757  KAYYEQFNISHNIEQVGYHGYVNTEIEQLILESFKVEKPIYEQLEVAINQVHAKYFDISC
                    ************************************************************

    COL             VPILTRSQKSLQGILVVMHDITNLKQLENLRREFVANVSHELKTPITSIKGFAETLIDGA
    N315            VPILTRSQKSLQGILVVMHDITNLKQLENLRREFVANVSHELKTPITSIKGFAETLIDGA
    NCTC8325        VPILTRSQKSLQGILVVMHDITNLKQLENLRREFVANVSHELKTPITSIKGFAETLIDGA
    Newman          VPILTRSQKSLQGILVVMHDITNLKQLENLRREFVANVSHELKTPITSIKGFAETLIDGA
    USA300_FPR3757  VPILTRSQKSLQGILVVMHDITNLKQLENLRREFVANVSHELKTPITSIKGFAETLIDGA
                    ************************************************************

    COL             KNDAESLDMFLNIILKESNRIESLVTDLLDLSHIEQHTELDTDYMNLSDLTRRIIDNMMT
    N315            KNDAESLDMFLNIILKESNRIESLVTDLLDLSHIEQHTELDTDYMNLSDLTRRIIDNMMT
    NCTC8325        KNDAESLDMFLNIILKESNRIESLVTDLLDLSHIEQHTELDTDYMNLSDLTRRIIDNMMT
    Newman          KNDAESLDMFLNIILKESNRIESLVTDLLDLSHIEQHTELDTDYMNLSDLTRRIIDNMMT
    USA300_FPR3757  KNDAESLDMFLNIILKESNRIESLVTDLLDLSHIEQHTELDTDYMNLSDLTRRIIDNMMT
                    ************************************************************

    COL             QANQKNISIHTDIEKDVIVKAQESKIAQVITNLLTNAINYSYEDGDINVRVYRDDFRVIF
    N315            QANQKNISIHTDIEKDVIVKAQESKIAQVITNLLTNAINYSYEDGDINVRVYRDDFRVIF
    NCTC8325        QANQKNISIHTDIEKDVIVKAQESKIAQVITNLLTNAINYSYEDGDINVRVYRDDFRVIF
    Newman          QANQKNISIHTDIEKDVIVKAQESKIAQVITNLLTNAINYSYEDGDINVRVYRDDFRVIF
    USA300_FPR3757  QANQKNISIHTDIEKDVIVKAQESKIAQVITNLLTNAINYSYEDGDINVRVYRDDFRVIF
                    ************************************************************

    COL             EVQDFGIGIKLEDQQRIFERFYRVDKARSRDSGGTGLGLSITKHIVEAHQGNIEVNSQVG
    N315            EVQDFGIGIKLEDQQRIFERFYRVDKARSRDSGGTGLGLSITKHIVEAHQGNIEVNSQVG
    NCTC8325        EVQDFGIGIKLEDQQRIFERFYRVDKARSRDSGGTGLGLSITKHIVEAHQGNIEVNSQVG
    Newman          EVQDFGIGIKLEDQQRIFERFYRVDKARSRDSGGTGLGLSITKHIVEAHQGNIEVNSQVG
    USA300_FPR3757  EVQDFGIGIKLEDQQRIFERFYRVDKARSRDSGGTGLGLSITKHIVEAHQGNIEVNSQVG
                    ************************************************************

    COL             KGSTFKVILKDYKE
    N315            KGSTFKVILKDYKE
    NCTC8325        KGSTFKVILKDYKE
    Newman          KGSTFKVILKDYKE
    USA300_FPR3757  KGSTFKVILKDYKE
                    **************