From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004324000
  • symbol?: pykA
  • description?: pyruvate kinase
  • strand?: -
  • coordinates?: 4567313..4569070
  • synteny block?: BlockID0033480
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1745 (pyk)
    N315:
    SA1520 (pykA)
    NCTC8325:
    Newman:
    NWMN_1592 (pykA)
    USA300_FPR3757:
    04-02981:
    SA2981_1656 (pykA)
    08BA02176:
    C248_1739 (pyk)
    11819-97:
    MS7_1704 (pyk)
    71193:
    ST398NM01_1751
    ECT-R 2:
    ECTR2_1537 (pyk)
    ED133:
    SAOV_1685 (pyk)
    ED98:
    SAAV_1687 (pyk)
    HO 5096 0412:
    SAEMRSA15_16070 (pyk)
    JH1:
    SaurJH1_1788
    JH9:
    SaurJH9_1754
    JKD6008:
    SAA6008_01666 (pykA)
    JKD6159:
    SAA6159_01621 (pykA)
    LGA251:
    SARLGA251_15890 (pyk)
    M013:
    M013TW_1710
    MRSA252:
    SAR1776 (pyk)
    MSHR1132:
    SAMSHR1132_15480
    MSSA476:
    SAS1625
    Mu3:
    SAHV_1683 (pykA)
    Mu50:
    SAV1697 (pykA)
    MW2:
    MW1641 (pykA)
    RF122:
    SAB1556c (pyk)
    ST398:
    SAPIG1751 (pyk)
    T0131:
    SAT0131_01801
    TCH60:
    HMPREF0772_11454 (pyk)
    TW20:
    SATW20_16890 (pyk)
    USA300_TCH1516:
    USA300HOU_1684 (pykA)
    VC40:
    SAVC_07700

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRKTKIVCTIGPASESEEMIEKLINAGMNVARLNFSHGSHEEHKGRIDTIRKVAKRLDKI
    N315            MRKTKIVCTIGPASESEEMIEKLINAGMNVARLNFSHGSHEEHKGRIDTIRKVAKRLDKI
    NCTC8325        MRKTKIVCTIGPASESEEMIEKLINAGMNVARLNFSHGSHEEHKGRIDTIRKVAKRLDKI
    Newman          MRKTKIVCTIGPASESEEMIEKLINAGMNVARLNFSHGSHEEHKGRIDTIRKVAKRLDKI
    USA300_FPR3757  MRKTKIVCTIGPASESEEMIEKLINAGMNVARLNFSHGSHEEHKGRIDTIRKVAKRLDKI
                    ************************************************************

    COL             VAILLDTKGPEIRTHNMKDGIIELERGNEVIVSMNEVEGTPEKFSVTYENLINDVQVGSY
    N315            VAILLDTKGPEIRTHNMKDGIIELERGNEVIVSMNEVEGTPEKFSVTYENLINDVQVGSY
    NCTC8325        VAILLDTKGPEIRTHNMKDGIIELERGNEVIVSMNEVEGTPEKFSVTYENLINDVQVGSY
    Newman          VAILLDTKGPEIRTHNMKDGIIELERGNEVIVSMNEVEGTPEKFSVTYENLINDVQVGSY
    USA300_FPR3757  VAILLDTKGPEIRTHNMKDGIIELERGNEVIVSMNEVEGTPEKFSVTYENLINDVQVGSY
                    ************************************************************

    COL             ILLDDGLIELQVKDIDHAKKEVKCDILNSGELKNKKGVNLPGVRVSLPGITEKDAEDIRF
    N315            ILLDDGLIELQVKDIDHAKKEVKCDILNSGELKNKKGVNLPGVRVSLPGITEKDAEDIRF
    NCTC8325        ILLDDGLIELQVKDIDHAKKEVKCDILNSGELKNKKGVNLPGVRVSLPGITEKDAEDIRF
    Newman          ILLDDGLIELQVKDIDHAKKEVKCDILNSGELKNKKGVNLPGVRVSLPGITEKDAEDIRF
    USA300_FPR3757  ILLDDGLIELQVKDIDHAKKEVKCDILNSGELKNKKGVNLPGVRVSLPGITEKDAEDIRF
                    ************************************************************

    COL             GIKENVDFIAASFVRRPSDVLEIREILEEQKANISVFPKIENQEGIDNIAEILEVSDGLM
    N315            GIKENVDFIAASFVRRPSDVLEIREILEEQKANISVFPKIENQEGIDNIAEILEVSDGLM
    NCTC8325        GIKENVDFIAASFVRRPSDVLEIREILEEQKANISVFPKIENQEGIDNIAEILEVSDGLM
    Newman          GIKENVDFIAASFVRRPSDVLEIREILEEQKANISVFPKIENQEGIDNIAEILEVSDGLM
    USA300_FPR3757  GIKENVDFIAASFVRRPSDVLEIREILEEQKANISVFPKIENQEGIDNIAEILEVSDGLM
                    ************************************************************

    COL             VARGDMGVEIPPEKVPMVQKDLIRQCNKLGKPVITATQMLDSMQRNPRATRAEASDVANA
    N315            VARGDMGVEIPPEKVPMVQKDLIRQCNKLGKPVITATQMLDSMQRNPRATRAEASDVANA
    NCTC8325        VARGDMGVEIPPEKVPMVQKDLIRQCNKLGKPVITATQMLDSMQRNPRATRAEASDVANA
    Newman          VARGDMGVEIPPEKVPMVQKDLIRQCNKLGKPVITATQMLDSMQRNPRATRAEASDVANA
    USA300_FPR3757  VARGDMGVEIPPEKVPMVQKDLIRQCNKLGKPVITATQMLDSMQRNPRATRAEASDVANA
                    ************************************************************

    COL             IYDGTDAVMLSGETAAGLYPEEAVKTMRNIAVSAEAAQDYKKLLSDRTKLVETSLVNAIG
    N315            IYDGTDAVMLSGETAAGLYPEEAVKTMRNIAVSAEAAQDYKKLLSDRTKLVETSLVNAIG
    NCTC8325        IYDGTDAVMLSGETAAGLYPEEAVKTMRNIAVSAEAAQDYKKLLSDRTKLVETSLVNAIG
    Newman          IYDGTDAVMLSGETAAGLYPEEAVKTMRNIAVSAEAAQDYKKLLSDRTKLVETSLVNAIG
    USA300_FPR3757  IYDGTDAVMLSGETAAGLYPEEAVKTMRNIAVSAEAAQDYKKLLSDRTKLVETSLVNAIG
                    ************************************************************

    COL             ISVAHTALNLNVKAIVAATESGSTARTISKYRPHSDIIAVTPSEETARQCSIVWGVQPVV
    N315            ISVAHTALNLNVKAIVAATESGSTARTISKYRPHSDIIAVTPSEETARQCSIVWGVQPVV
    NCTC8325        ISVAHTALNLNVKAIVAATESGSTARTISKYRPHSDIIAVTPSEETARQCSIVWGVQPVV
    Newman          ISVAHTALNLNVKAIVAATESGSTARTISKYRPHSDIIAVTPSEETARQCSIVWGVQPVV
    USA300_FPR3757  ISVAHTALNLNVKAIVAATESGSTARTISKYRPHSDIIAVTPSEETARQCSIVWGVQPVV
                    ************************************************************

    COL             KKGRKSTDALLNNAVATAVETGRVSNGDLIIITAGVPTGETGTTNMMKIHLVGDEIANGQ
    N315            KKGRKSTDALLNNAVATAVETGRVSNGDLIIITAGVPTGETGTTNMMKIHLVGDEIANGQ
    NCTC8325        KKGRKSTDALLNNAVATAVETGRVSNGDLIIITAGVPTGETGTTNMMKIHLVGDEIANGQ
    Newman          KKGRKSTDALLNNAVATAVETGRVSNGDLIIITAGVPTGETGTTNMMKIHLVGDEIANGQ
    USA300_FPR3757  KKGRKSTDALLNNAVATAVETGRVSNGDLIIITAGVPTGETGTTNMMKIHLVGDEIANGQ
                    ************************************************************

    COL             GIGRGSVVGTTLVAETVKDLEGKDLSDKVIVTNSIDETFVPYVEKALGLITEENGITSPS
    N315            GIGRGSVVGTTLVAETVKDLEGKDLSDKVIVTNSIDETFVPYVEKALGLITEENGITSPS
    NCTC8325        GIGRGSVVGTTLVAETVKDLEGKDLSDKVIVTNSIDETFVPYVEKALGLITEENGITSPS
    Newman          GIGRGSVVGTTLVAETVKDLEGKDLSDKVIVTNSIDETFVPYVEKALGLITEENGITSPS
    USA300_FPR3757  GIGRGSVVGTTLVAETVKDLEGKDLSDKVIVTNSIDETFVPYVEKALGLITEENGITSPS
                    ************************************************************

    COL             AIVGLEKGIPTVVGVEKAVKNISNNMLVTIDAAQGKIFEGYANVL
    N315            AIVGLEKGIPTVVGVEKAVKNISNNMLVTIDAAQGKIFEGYANVL
    NCTC8325        AIVGLEKGIPTVVGVEKAVKNISNNMLVTIDAAQGKIFEGYANVL
    Newman          AIVGLEKGIPTVVGVEKAVKNISNNMLVTIDAAQGKIFEGYANVL
    USA300_FPR3757  AIVGLEKGIPTVVGVEKAVKNISNNMLVTIDAAQGKIFEGYANVL
                    *********************************************