From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004385000
  • symbol?: ptaA
  • description?: PTS glucose transporter subunit IIBC

      descriptions from strain specific annotations:

    • PTS glucose transporter subunit IIBC
    • PTS system, IIBC components
    • PTS system N-acetylglucosamine-specific transporter subunit IIABC
    • PTS system, N-acetylglucosamine-specific IIBC component
    • phosphotransferase system, N-acetylglucosamine-specific IIBC component
    • PTS family porter component IIBC
    • PTS system, N-acetylglucosamine-specific IIABC component
    • PTS system, N-acetylglucosamine-specific IIB component / PTS system, N-acetylglucosamine-specific IIC component
    • PTS system, N-acetylglucosamine-specific IIBC subunit
    • PTS system IIBC component
    • PTS system N-acetylglucosamine-specific IIABC component
    • PTS system N-acetylglucosamine-specific transporter subunit IIBC
    • PTS system transporter subunit IIBC
  • strand?: -
  • coordinates?: 4623423..4624889
  • synteny block?: BlockID0033890
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1547 (ptaA)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1684 (ptaA)
    08BA02176:
    C248_1768
    11819-97:
    MS7_1732 (nagE)
    71193:
    ST398NM01_1778
    ECT-R 2:
    ECTR2_1566 (nagE)
    ED133:
    SAOV_1712
    ED98:
    SAAV_1736
    HO 5096 0412:
    SAEMRSA15_16340
    JH1:
    SaurJH1_1816
    JH9:
    SaurJH9_1781
    JKD6008:
    SAA6008_01694 (ptaA)
    JKD6159:
    SAA6159_01649 (ptaA)
    LGA251:
    SARLGA251_16160
    M013:
    M013TW_1740
    MRSA252:
    SAR1803
    MSHR1132:
    SAMSHR1132_15760
    MSSA476:
    SAS1652
    Mu3:
    SAHV_1712 (ptaA)
    Mu50:
    SAV1726 (ptaA)
    MW2:
    MW1668 (ptaA)
    RF122:
    SAB1584c
    ST398:
    SAPIG1778 (nagE)
    T0131:
    SAT0131_01829 (pbp4)
    TCH60:
    HMPREF0772_11427 (nagE)
    TW20:
    SATW20_17160
    USA300_TCH1516:
    USA300HOU_1715
    VC40:
    SAVC_07835

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYKFFQNLGRSLMLPVAILPAAAIIAGIGNTLNALHATPKIAMFFTTVGTTILEQLGILF
    N315            MYKFFQNLGRSLMLPVAILPAAAIIAGIGNTLNALHATPKIAMFFTTVGTTILEQLGILF
    NCTC8325        MYKFFQNLGRSLMLPVAILPAAAIIAGIGNTLNALHATPKIAMFFTTVGTTILEQLGILF
    Newman          MYKFFQNLGRSLMLPVAILPAAAIIAGIGNTLNALHATPKIAMFFTTVGTTILEQLGILF
    USA300_FPR3757  MYKFFQNLGRSLMLPVAILPAAAIIAGIGNTLNALHATPKIAMFFTTVGTTILEQLGILF
                    ************************************************************

    COL             AIGVAIGMAKKNDGAVALAATLGYFLVTVVLSPMKLAPLLGMKASEINSAFEKMNNGNVF
    N315            AIGVAIGMAKKNDGAVALAATLGYFLVTVVLSPMKLAPLLGMKASEINSAFEKMNNGNVF
    NCTC8325        AIGVAIGMAKKNDGAVALAATLGYFLVTVVLSPMKLAPLLGMKASEINSAFEKMNNGNVF
    Newman          AIGVAIGMAKKNDGAVALAATLGYFLVTVVLSPMKLAPLLGMKASEINSAFEKMNNGNVF
    USA300_FPR3757  AIGVAIGMAKKNDGVVALAATLGYFLVTVVLSPMKLAPLLGMKASEINSAFEKMNNGNVF
                    **************.*********************************************

    COL             VGIVIGLIAAYAYNKFSETELPLALSFFSGKRLVPIMTAFYCTFLVVILLFLWPLLYSWI
    N315            VGIVIGLIAAYAYNKFSETELPLALSFFSGKRLVPIMTAFYCTFLVVILLFLWPLLYSWI
    NCTC8325        VGIVIGLIAAYAYNKFSETELPLALSFFSGKRLVPIMTAFYCTFLVVILLFLWPLLYSWI
    Newman          VGIVIGLIAAYAYNKFSETELPLALSFFSGKRLVPIMTAFYCTFLVVILLFLWPLLYSWI
    USA300_FPR3757  VGIVIGLIAAYAYNKFSETELPLALSFFSGKRLVPIMTAFYCTFLVVILLFLWPLLYSWI
                    ************************************************************

    COL             VKFGESIVGLGSFGAFIYGVANRLLIPTGLHHALNSVFWFDTIGINDIGKFQSGKDAIKG
    N315            VKFGESIVGLGSFGAFIYGVANRLLIPTGLHHALNSVFWFDTIGINDIGKFQSGKDAIKG
    NCTC8325        VKFGESIVGLGSFGAFIYGVANRLLIPTGLHHALNSVFWFDTIGINDIGKFQSGKDAIKG
    Newman          VKFGESIVGLGSFGAFIYGVANRLLIPTGLHHALNSVFWFDTIGINDIGKFQSGKDAIKG
    USA300_FPR3757  VKFGESIVGLGSFGAFIYGVANRLLIPTGLHHALNSVFWFDTIGINDIGKFQSGKDAIKG
                    ************************************************************

    COL             ITGRYQAGFFPIMMFGIPAAALAMYHTAKTTQKKQVYGWFLASSVAAFFVGVTEPIEFAF
    N315            ITGRYQAGFFPIMMFGIPAAALAMYHTAKTTQKKQVYGWFLASSVAAFFVGVTEPIEFAF
    NCTC8325        ITGRYQAGFFPIMMFGIPAAALAMYHTAKTTQKKQVYGWFLASSVAAFFVGVTEPIEFAF
    Newman          ITGRYQAGFFPIMMFGIPAAALAMYHTAKTTQKKQVYGWFLASSVAAFFVGVTEPIEFAF
    USA300_FPR3757  ITGRYQAGFFPIMMFGIPAAALAMYHTAKTTQKKQVYGWFLASSVAAFFVGVTEPIEFAF
                    ************************************************************

    COL             MFVAPILYVVHALLTGLSLFIAATFHWTAGFSFSAGLIDYVLSLINPVSNHPLMLLVQGV
    N315            MFVAPILYVVHALLTGLSLFIAATFHWTAGFSFSAGLIDYVLSLINPVSNHPLMLLVQGV
    NCTC8325        MFVVPILYVVHALLTGLSLFIAATFHWTAGFSFSAGLIDYVLSLINPVSNHPLMLLVQGV
    Newman          MFVAPILYVVHALLTGLSLFIAATFHWTAGFSFSAGLIDYVLSLINPVSNHPLMLLVQGV
    USA300_FPR3757  MFVAPILYVVHALLTGLSLFIAATFHWTAGFSFSAGLIDYVLSLINPVSNHPLMLLVQGV
                    ***.********************************************************

    COL             VFFILYYVIFRVVIQVFNLNTIGRGENELVDPTVVKDNIAPGENDIKQSKYHQHAIQILE
    N315            VFFILYYVIFRVVIQVFNLNTIGRGENELVDPTVVKDNIAPGENDIKQSKYHQHAIQILE
    NCTC8325        VFFILYYVIFRVVIQVFNLNTIGRGENELVDPTVVKDNIAPGENDIKQSKYHQHAIQILE
    Newman          VFFILYYVIFRVVIQVFNLNTIGRGENELVDPTVVKDNIAPGENDIKQSKYHQHAIQILE
    USA300_FPR3757  VFFILYYVIFRVVIQVFNLNTIGRGENELVDPTVVKDNIAPGENDIKQSKYHQHAIQILE
                    ************************************************************

    COL             GLGGQENIVNLTNCATRLRLELKDTSIIDKQKIKNAGAVGVTVNGKHSTQVIVGTHVQQV
    N315            GLGGQENIVNLTNCATRLRLELKDTSIIDQQKIKNAGAVGVTVNGKHSTQVIVGTHVQQV
    NCTC8325        GLGGQENIVNLTNCATRLRLELKDTSIIDKQKIKNAGAVGVTVNGKHSTQVIVGTHVQQV
    Newman          GLGGQENIVNLTNCATRLRLELKDTSIIDKQKIKNAGAVGVTVNGKHSTQVIVGTHVQQV
    USA300_FPR3757  GLGGQENIVNLTNCATRLRLELKDTSIIDKQKIKNAGAVGVTVNGKHSTQVIVGTHVQQV
                    *****************************:******************************

    COL             ADEIEKHL
    N315            ADEIEKHL
    NCTC8325        ADEIEKHL
    Newman          ADEIEKHL
    USA300_FPR3757  ADEIEKHL
                    ********