From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004399000
  • symbol?: acuC
  • description?: acetoin utilization protein

      descriptions from strain specific annotations:

    • acetoin utilization protein
    • histone deacetylase superfamily protein
    • acetoin utilization protein AcuC
    • NAD-independent protein deacetylase AcuC
    • histone deacetylase family protein
    • acetoin utilization acuC protein
  • strand?: +
  • coordinates?: 4639248..4640399
  • synteny block?: BlockID0034030
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1785 (acuC)
    N315:
    SA1556 (acuC)
    NCTC8325:
    Newman:
    NWMN_1628 (acuC)
    USA300_FPR3757:
    04-02981:
    SA2981_1693 (acuC)
    08BA02176:
    C248_1779
    11819-97:
    MS7_1741 (acuC)
    71193:
    ST398NM01_1787
    ECT-R 2:
    ECTR2_1575
    ED133:
    SAOV_1721 (acuC)
    ED98:
    SAAV_1745 (acuC)
    HO 5096 0412:
    SAEMRSA15_16430
    JH1:
    SaurJH1_1825
    JH9:
    SaurJH9_1790
    JKD6008:
    SAA6008_01705 (acuC)
    JKD6159:
    SAA6159_01658 (acuC)
    LGA251:
    SARLGA251_16250
    M013:
    M013TW_1749
    MRSA252:
    SAR1813
    MSHR1132:
    SAMSHR1132_15850
    MSSA476:
    SAS1661
    Mu3:
    SAHV_1721 (acuC)
    Mu50:
    SAV1735 (acuC)
    MW2:
    MW1678 (acuC)
    RF122:
    SAB1595 (acuC)
    ST398:
    SAPIG1787
    T0131:
    SAT0131_01840
    TCH60:
    HMPREF0772_11418 (acuC)
    TW20:
    SATW20_17250
    USA300_TCH1516:
    USA300HOU_1724 (acuC)
    VC40:
    SAVC_07885

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQQHSSKTAYVYSDKLLQYRFHDQHPFNQMRLKLTTELLLNANLLSPEQIVQPRIATDDE
    N315            MQQHSSKTAYVYSDKLLQYRFHDQHPFNQMRLKLTTELLLNANLLSPEQIVQPRIATGDE
    NCTC8325        MQQHSSKTAYVYSDKLLQYRFHDQHPFNQMRLKLTTELLLNANLLSPEQIVQPRIATDDE
    Newman          MQQHSSKTAYVYSDKLLQYRFHDQHPFNQMRLKLTTELLLNANLLSPEQIVQPRIATDDE
    USA300_FPR3757  MQQHSSKTAYVYSDKLLQYRFHDQHPFNQMRLKLTTELLLNANLLSPEQIVQPRIATDDE
                    *********************************************************.**

    COL             LMLIHKYDYVEAIKHASHGIISEDEAKKYGLNDEENGQFKHMHRHSATIVGGALTLADLI
    N315            LMLIHKYDYVEAIKHASHGIISEDEAKKYGLNDEENGQFKHMHRHSATIVGGALTLADLI
    NCTC8325        LMLIHKYDYVEAIKHASHGIISEDEAKKYGLNDEENGQFKHMHRHSATIVGGALTLADLI
    Newman          LMLIHKYDYVEAIKHASHGIISEDEAKKYGLNDEENGQFKHMHRHSATIVGGALTLADLI
    USA300_FPR3757  LMLIHKYDYVEAIKHASHGIISEDEAKKYGLNDEENGQFKHMHRHSATIVGGALTLADLI
                    ************************************************************

    COL             MSGKVLNGCHLGGGLHHAQPGRASGFCIYNDIAITAQYLAKEYNQRVLIIDTDAHHGDGT
    N315            MSGKVLNGCHLGGGLHHAQPGRASGFCIYNDIAITAQYIAKEYNQRVLIIDTDAHHGDGT
    NCTC8325        MSGKVLNGCHLGGGLHHAQPGRASGFCIYNDIAITAQYLAKEYNQRVLIIDTDAHHGDGT
    Newman          MSGKVLNGCHLGGGLHHAQPGRASGFCIYNDIAITAQYLAKEYNQRVLIIDTDAHHGDGT
    USA300_FPR3757  MSGKVLNGCHLGGGLHHAQPGRASGFCIYNDIAITAQYLAKEYNQRVLIIDTDAHHGDGT
                    **************************************:*********************

    COL             QWSFYADNHVTTYSIHETGKFLFPGSGHYTERGEDIGYGHTVNVPLEPYTEDASFLECFK
    N315            QWSFYADNHVTTYSIHETGKFLFPGSGHYTERGEDIGYGHTVNVPLEPYTEDASFLECFK
    NCTC8325        QWSFYADNHVTTYSIHETGKFLFPGSGHYTERGEDIGYGHTVNVPLEPYTEDASFLECFK
    Newman          QWSFYADNHVTTYSIHETGKFLFPGSGHYTERGEDIGYGHTVNVPLEPYTEDASFLECFK
    USA300_FPR3757  QWSFYADNHVTTYSIHETGKFLFPGSGHYTERGEDIGYGHTVNVPLEPYTEDASFLECFK
                    ************************************************************

    COL             LTVEPVVKSFKPDIILSVNGVDIHYRDPLTHLNCTLHSLYEIPYFVKYLADSYTNGKVIM
    N315            LTVEPVVKSFKPDIILSVNGVDIHYRDPLTHLNCTLHSLYEIPYFVKYLADSYTNGKVIM
    NCTC8325        LTVEPVVKSFKPDIILSVNGVDIHYRDPLTHLNCTLHSLYEIPYFVKYLADSYTNGKVIM
    Newman          LTVEPVVKSFKPDIILSVNGVDIHYRDPLTHLNCTLHSLYEIPYFVKYLADSYTNGKVIM
    USA300_FPR3757  LTVEPVVKSFKPDIILSVNGVDIHYRDPLTHLNCTLHSLYEIPYFVKYLADSYTNGKVIM
                    ************************************************************

    COL             FGGGGYNIWRVVPRAWSHVFLSLIDQPIQSGYLPLEWINKWKHYSSELLPKRWEDRLNDY
    N315            FGGGGYNIWRVVPRAWSHVFLSLIDQPIQSGYLPLEWINKWKHYSSELLPKRWEDRLNDY
    NCTC8325        FGGGGYNIWRVVPRAWSHVFLSLIDQPIQSGYLPLEWINKWKHYSSELLPKRWEDRLNDY
    Newman          FGGGGYNIWRVVPRAWSHVFLSLIDQPIQSGYLPLEWINKWKHYSSELLPKRWEDRLNDY
    USA300_FPR3757  FGGGGYNIWRVVPRAWSHVFLSLIDQPIQSGYLPLEWINKWKHYSSELLPKRWEDRLNDY
                    ************************************************************

    COL             TYVPRTKEISEKNKKLALHIASWYESTRQ
    N315            TYVPRTKEISEKNKKLALHIASWYESTRQ
    NCTC8325        TYVPRTKEISEKNKKLALHIASWYESTRQ
    Newman          TYVPRTKEISEKNKKLALHIASWYESTRQ
    USA300_FPR3757  TYVPRTKEISEKNKKLALHIASWYESTRQ
                    *****************************