From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004428000
  • symbol?: dat
  • description?: D-alanine aminotransferase

      descriptions from strain specific annotations:

    • D-alanine aminotransferase
    • D-amino acid aminotransferase
    • D-amino-acid transaminase
    • putative D-alanine aminotransferase
  • strand?: -
  • coordinates?: 4674511..4675359
  • synteny block?: BlockID0034260
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1800 (dat)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1708
    08BA02176:
    C248_1797 (dat)
    11819-97:
    MS7_1756 (dat)
    71193:
    ST398NM01_1803
    ECT-R 2:
    ECTR2_1590 (dat)
    ED133:
    SAOV_1736
    ED98:
    SAAV_1760 (dat)
    HO 5096 0412:
    SAEMRSA15_16580 (dat)
    JH1:
    SaurJH1_1840
    JH9:
    SaurJH9_1805
    JKD6008:
    SAA6008_01722 (dat)
    JKD6159:
    SAA6159_01673 (dat)
    LGA251:
    SARLGA251_16400 (dat)
    M013:
    M013TW_1765
    MRSA252:
    SAR1835 (dat)
    MSHR1132:
    SAMSHR1132_16000
    MSSA476:
    SAS1676
    Mu3:
    SAHV_1736
    Mu50:
    SAV1750
    MW2:
    MW1693
    RF122:
    SAB1610c (dat)
    ST398:
    SAPIG1803 (dat)
    T0131:
    SAT0131_01859
    TCH60:
    HMPREF0772_11402 (dat)
    TW20:
    SATW20_17400 (dat)
    USA300_TCH1516:
    USA300HOU_1741 (daaA)
    VC40:
    SAVC_07960

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEKIFLNGEFVSPSEAKVSYNDRGYVFGDGIYEYIRVYNGKLFTVTEHYERFLRSANEIG
    N315            MEKIFLNGEFVSPSEAKVSYNDRGYVFGDGIYEYIRVYNGKLFTVTEHYERFLRSANEIG
    NCTC8325        MEKIFLNGEFVSPSEAKVSYNDRGYVFGDGIYEYIRVYNGKLFTVTEHYERFLRSANEIG
    Newman          MEKIFLNGEFVSPSEAKVSYNDRGYVFGDGIYEYIRVYNGKLFTVTEHYERFLRSANEIG
    USA300_FPR3757  MEKIFLNGEFVSPSEAKVSYNDRGYVFGDGIYEYIRVYNGKLFTVTEHYERFLRSANEIG
                    ************************************************************

    COL             LDLNYSVEELIELSRKLVDMNQIETGAIYIQATRGVAERNHSFPTPEVEPAIVAYTKSYD
    N315            LDLNYSVEELIELSRKLVDMNQIETGAIYIQATRGVAERNHSFPTPEVEPAIVAYTKSYD
    NCTC8325        LDLNYSVEELIELSRKLVDMNQIETGAIYIQATRGVAERNHSFPTPEVEPAIVAYTKSYD
    Newman          LDLNYSVEELIELSRKLVDMNQIETGAIYIQATRGVAERNHSFPTPEVEPAIVAYTKSYD
    USA300_FPR3757  LDLNYSVEELIELSRKLVDMNQIETGAIYIQATRGVAERNHSFPTPEVEPAIVAYTKSYD
                    ************************************************************

    COL             RPYDHLENGVNGVTVEDIRWLRCDIKSLNLLGNVLAKEYAVKYNAVEAIQHRGETVTEGS
    N315            RPYDHLENGVNGVTVEDIRWLRCDIKSLNLLGNVLAKEYAVKYNAVEAIQHRGETVTEGS
    NCTC8325        RPYDHLENGVNGVTVEDIRWLRCDIKSLNLLGNVLAKEYAVKYNAVEAIQHRGETVTEGS
    Newman          RPYDHLENGVNGVTVEDIRWLRCDIKSLNLLGNVLAKEYAVKYNAVEAIQHRGETVTEGS
    USA300_FPR3757  RPYDHLENGVNGVTVEDIRWLRCDIKSLNLLGNVLAKEYAVKYNAVEAIQHRGETVTEGS
                    ************************************************************

    COL             SSNAYAIKDGVIYTHPINNYILNGITRIVIKKIAEDYNIPFKEETFTVDFLKNADEVIVS
    N315            SSNAYAIKDGVIYTHPINNYILNGITRIVIKKIAEDYNIPFKEETFTVDFLKNADEVIVS
    NCTC8325        SSNAYAIKDGVIYTHPINNYILNGITRIVIKKIAEDYNIPFKEETFTVDFLKNADEVIVS
    Newman          SSNAYAIKDGVIYTHPINNYILNGITRIVIKKIAEDYNIPFKEETFTVDFLKNADEVIVS
    USA300_FPR3757  SSNAYAIKDGVIYTHPINNYILNGITRIVIKKIAEDYNIPFKEETFTVDFLKNADEVIVS
                    ************************************************************

    COL             STSAEVTPVIKLDGEPVNDGKVGPITRQLQEGFEKYIESHSI
    N315            STSAEVTPVIKLDGEPINDGKVGPITRQLQEGFEKYIESHSI
    NCTC8325        STSAEVTPVIKLDGEPVNDGKVGPITRQLQEGFEKYIESHSI
    Newman          STSAEVTPVIKLDGEPVNDGKVGPITRQLQEGFEKYIESHSI
    USA300_FPR3757  STSAEVTPVIKLDGEPVNDGKVGPITRQLQEGFEKYIESHSI
                    ****************:*************************