From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1571 [new locus tag: SA_RS08860 ]
  • pan locus tag?: SAUPAN004428000
  • symbol: SA1571
  • pan gene symbol?: dat
  • synonym:
  • product: D-alanine aminotransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1571 [new locus tag: SA_RS08860 ]
  • symbol: SA1571
  • product: D-alanine aminotransferase
  • replicon: chromosome
  • strand: -
  • coordinates: 1801557..1802405
  • length: 849
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGGAAAAAATTTTTTTAAATGGTGAGTTTGTAAGTCCAAGTGAAGCAAAGGTTTCATAC
    AACGACAGAGGATACGTATTTGGCGATGGTATTTATGAATACATTCGAGTATATAATGGT
    AAGTTATTTACAGTAACAGAACATTATGAAAGATTTTTACGTAGTGCCAATGAGATTGGT
    TTAGATTTAAATTATTCTGTAGAAGAATTAATTGAACTATCTCGTAAATTAGTTGATATG
    AATCAAATTGAAACTGGGGCAATTTATATTCAAGCAACGCGTGGTGTAGCTGAAAGGAAT
    CATAGCTTCCCGACACCTGAAGTAGAACCAGCAATTGTTGCTTATACAAAGAGTTATGAT
    CGTCCTTATGATCATTTAGAAAATGGTGTGAATGGTGTTACCGTTGAAGATATCCGATGG
    TTACGTTGCGACATTAAAAGCTTGAACTTATTAGGAAATGTATTAGCAAAAGAATATGCT
    GTGAAATATAATGCAGTTGAAGCAATTCAACATCGAGGTGAAACTGTAACTGAAGGATCT
    TCAAGTAATGCTTATGCAATTAAAGACGGTGTGATTTATACACATCCGATTAACAACTAT
    ATTCTTAATGGTATTACACGAATTGTAATTAAAAAAATTGCCGAAGACTATAACATCCCA
    TTTAAAGAAGAAACGTTTACTGTAGATTTCTTGAAAAACGCAGATGAAGTTATTGTTTCA
    AGTACTTCAGCTGAGGTTACACCTGTTATTAAATTAGATGGTGAACCAATTAATGATGGT
    AAAGTTGGCCCAATTACACGTCAACTACAAGAAGGATTTGAAAAGTATATAGAGTCACAC
    AGTATTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    849

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1571 [new locus tag: SA_RS08860 ]
  • symbol: SA1571
  • description: D-alanine aminotransferase
  • length: 282
  • theoretical pI: 4.68119
  • theoretical MW: 31907.6
  • GRAVY: -0.316667

Function[edit source | edit]

  • reaction:
    EC 2.6.1.21?  ExPASy
    D-amino-acid transaminaseD-alanine + 2-oxoglutarate = pyruvate + D-glutamate
  • TIGRFAM:
    MetabolismEnergy metabolismAmino acids and aminesD-amino-acid transaminase (TIGR01121; EC 2.6.1.21; HMM-score: 445.2)
    MetabolismAmino acid biosynthesisPyruvate familybranched-chain amino acid aminotransferase (TIGR01122; EC 2.6.1.42; HMM-score: 176.1)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersFolic acidaminodeoxychorismate lyase (TIGR03461; EC 4.1.3.38; HMM-score: 91.5)
    MetabolismAmino acid biosynthesisPyruvate familybranched-chain amino acid aminotransferase (TIGR01123; EC 2.6.1.42; HMM-score: 36.6)
  • TheSEED:  
    CarbohydratesCentral carbohydrate metabolismPyruvate Alanine Serine Interconversions D-alanine aminotransferase (EC 2.6.1.21) 
  • PFAM:
    no clan definedAminotran_4; Amino-transferase class IV (PF01063; HMM-score: 137.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: pyridoxal 5'-phosphate
  • effectors:
  • protein partners:
    SA1160(nuc)thermonuclease  [1] (data from MRSA252)
    SA0865(ppnK)inorganic polyphosphate/ATP-NAD kinase  [1] (data from MRSA252)
    SA0627hypothetical protein  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.11
    • Ymax_pos: 22
    • Cmax: 0.13
    • Cmax_pos: 22
    • Smax: 0.115
    • Smax_pos: 16
    • Smean: 0.084
    • D: 0.1
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MEKIFLNGEFVSPSEAKVSYNDRGYVFGDGIYEYIRVYNGKLFTVTEHYERFLRSANEIGLDLNYSVEELIELSRKLVDMNQIETGAIYIQATRGVAERNHSFPTPEVEPAIVAYTKSYDRPYDHLENGVNGVTVEDIRWLRCDIKSLNLLGNVLAKEYAVKYNAVEAIQHRGETVTEGSSSNAYAIKDGVIYTHPINNYILNGITRIVIKKIAEDYNIPFKEETFTVDFLKNADEVIVSSTSAEVTPVIKLDGEPINDGKVGPITRQLQEGFEKYIESHSI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1 1.2 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]

Alexander Scherl, Patrice François, Manuela Bento, Jacques M Deshusses, Yvan Charbonnier, Véronique Converset, Antoine Huyghe, Nadia Walter, Christine Hoogland, Ron D Appel, Jean-Charles Sanchez, Catherine G Zimmermann-Ivol, Garry L Corthals, Denis F Hochstrasser, Jacques Schrenzel
Correlation of proteomic and transcriptomic profiles of Staphylococcus aureus during the post-exponential phase of growth.
J. Microbiol. Methods: 2005, 60(2);247-57
[PubMed:15590099] [WorldCat.org] [DOI] (P p)