From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004446000
  • symbol?:
  • description?: Fe-S oxidoreductase

      descriptions from strain specific annotations:

    • Fe-S oxidoreductase
    • radical SAM superfamily protein
    • putative Fe-S oxidoreductase
    • radical SAM protein
    • radical SAM protein, family
  • strand?: +
  • coordinates?: 4693950..4694903
  • synteny block?: BlockID0034430
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1718
    08BA02176:
    C248_1807
    11819-97:
    MS7_1766
    71193:
    ST398NM01_1813
    ECT-R 2:
    ECTR2_1600
    ED133:
    SAOV_1746
    ED98:
    SAAV_1771
    HO 5096 0412:
    SAEMRSA15_16680
    JH1:
    SaurJH1_1850
    JH9:
    SaurJH9_1815
    JKD6008:
    SAA6008_01732
    JKD6159:
    SAA6159_01683
    LGA251:
    SARLGA251_16500
    M013:
    M013TW_1776
    MRSA252:
    SAR1845
    MSHR1132:
    SAMSHR1132_16100
    MSSA476:
    SAS1686
    Mu3:
    SAHV_1748
    Mu50:
    SAV1762
    MW2:
    MW1703
    RF122:
    SAB1620
    ST398:
    SAPIG1813
    T0131:
    SAT0131_01871
    TCH60:
    HMPREF0772_11391
    TW20:
    SATW20_17500
    USA300_TCH1516:
    USA300HOU_1751
    VC40:
    SAVC_08010

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGNHFQYAFENKRYHTWNYHLKNKFGQKIFKVALDGGFDCPNRDGTVAHGGCTFCSAAGS
    N315            MGNHFQYAFENKRYHTWNYHLKNKFGQKIFKVALDGGFDCPNRDGTVAHGGCTFCSAAGS
    NCTC8325        MGNHFQYAFENKRYHTWNYHLKNKFGQKIFKVALDGGFDCPNRDGTVAHGGCTFCSAAGS
    Newman          MGNHFQYAFENKRYHTWNYHLKNKFGQKIFKVALDGGFDCPNRDGTVAHGGCTFCSAAGS
    USA300_FPR3757  MGNHFQYAFENKRYHTWNYHLKNKFGQKIFKVALDGGFDCPNRDGTVAHGGCTFCSAAGS
                    ************************************************************

    COL             GDFAGNRADSIAVQFKEIKEKMHEKWHEGKYIAYFQAFTNTHAPVEVLKEKFEPVLKEPG
    N315            GDFAGNRADSIAVQFKEIKEKMHEKWHEGKYIAYFQAFTNTHAPVEVLKEKFEPVLKEPG
    NCTC8325        GDFAGNRADSIAVQFKEIKEKMHEKWHEGKYIAYFQAFTNTHAPVEVLKEKFEPVLKEPG
    Newman          GDFAGNRADSIAVQFKEIKEKMHEKWHEGKYIAYFQAFTNTHAPVEVLKEKFEPVLKEPG
    USA300_FPR3757  GDFAGNRADSIAVQFKEIKEKMHEKWHEGKYIAYFQAFTNTHAPVEVLKEKFEPVLKEPG
                    ************************************************************

    COL             VVGLSIGTRPDCLPDDVVEYLADLNQRTYLWVELGLQTIHQSTSDLINRAHDMKTYYDGV
    N315            VVGLSIGTRPDCLPDDVVEYLADLNQRTYLWVELGLQTIHQSTSDLINRAHDMKTYYDGV
    NCTC8325        VVGLSIGTRPDCLPDDVVEYLADLNQRTYLWVELGLQTIHQSTSDLINRAHDMKTYYDGV
    Newman          VVGLSIGTRPDCLPDDVVEYLADLNQRTYLWVELGLQTIHQSTSDLINRAHDMKTYYDGV
    USA300_FPR3757  VVGLSIGTRPDCLPDDVVEYLADLNQRTYLWVELGLQTIHQSTSDLINRAHDMKTYYDGV
                    ************************************************************

    COL             AKLRKHNINVCTHIINGLPGEDYDMMMATAKEVAQMDVQGIKIHLLHLLKGTPMVKQYDK
    N315            AKLRKHNINVCTHIINGLPGEDYDMMMATAKEVAQMDVQGIKIHLLHLLKGTPMVKQYDK
    NCTC8325        AKLRKHNINVCTHIINGLPGEDYDMMMATAKEVAQMDVQGIKIHLLHLLKGTPMVKQYDK
    Newman          AKLRKHNINVCTHIINGLPGEDYDMMMATAKEVAQMDVQGIKIHLLHLLKGTPMVKQYDK
    USA300_FPR3757  AKLRKHNINVCTHIINGLPGEDYDMMMATAKEVAQMDVQGIKIHLLHLLKGTPMVKQYDK
                    ************************************************************

    COL             GLLTFMTQEEYTNLVVDQLEVIPPEMIVHRITGDGPIDIMVGPMWSVNKWEVLNGIDAEL
    N315            GLLTFMTQEEYTNLVVDQLEVIPPEMIVHRITGDGPIDIMVGPMWSVNKWEVLNGIDAEL
    NCTC8325        GLLTFMTQEEYTNLVVDQLEVIPPEMIVHRITGDGPIDIMVGPMWSVNKWEVLNGIDAEL
    Newman          GLLTFMTQEEYTNLVVDQLEVIPPEMIVHRITGDGPIDIMVGPMWSVNKWEVLNGIDAEL
    USA300_FPR3757  GLLTFMTQEEYTNLVVDQLEVIPPEMIVHRITGDGPIDIMVGPMWSVNKWEVLNGIDAEL
                    ************************************************************

    COL             ARRNSYQGLRYKSKVKQ
    N315            ARRNSYQGLRYKSKVKQ
    NCTC8325        ARRNSYQGLRYKSKVKQ
    Newman          ARRNSYQGLRYKSKVKQ
    USA300_FPR3757  ARRNSYQGLRYKSKVKQ
                    *****************