From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: saupan004447000
  • symbol?:
  • description?: SAM-dependent methyltransferase, MraW methylase family

      descriptions from strain specific annotations:

    • SAM-dependent methyltransferase, MraW methylase family
    • rRNA methylase family protein
    • putative rRNA methylase
    • rRNA methyltransferase
    • conserved protein YtqB
  • strand?: +
  • coordinates?: 4694900..4695463
  • synteny block?: BlockID0034440
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1719
    08BA02176:
    C248_1808
    11819-97:
    MS7_1767
    71193:
    ST398NM01_1814
    ECT-R 2:
    ECTR2_1601
    ED133:
    SAOV_1747
    ED98:
    SAAV_1772
    HO 5096 0412:
    SAEMRSA15_16690
    JH1:
    SaurJH1_1851
    JH9:
    SaurJH9_1816
    JKD6008:
    SAA6008_01733
    JKD6159:
    SAA6159_01684
    LGA251:
    SARLGA251_16510
    M013:
    M013TW_1777
    MRSA252:
    SAR1846
    MSHR1132:
    SAMSHR1132_16110
    MSSA476:
    SAS1687
    Mu3:
    SAHV_1749
    Mu50:
    SAV1763
    MW2:
    MW1704
    RF122:
    SAB1621
    ST398:
    SAPIG1814
    T0131:
    SAT0131_01873
    TCH60:
    HMPREF0772_11390
    TW20:
    SATW20_17510
    USA300_TCH1516:
    USA300HOU_1752
    VC40:
    SAVC_08015

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKLERILPFSKTLIKQHITPESIVVDATCGNGNDTLFLAEQVPEGHVYGFDIQDLALENT
    N315            MKLERILPFSKTLIKQHITPESIVVDATCGNGNDTLFLAEQVPEGHVYGFDIQDLALENT
    NCTC8325        MKLERILPFSKTLIKQHITPESIVVDATCGNGNDTLFLAEQVPEGHVYGFDIQDLALENT
    Newman          MKLERILPFSKTLIKQHITPESIVVDATCGNGNDTLFLAEQVPEGHVYGFDIQDLALENT
    USA300_FPR3757  MKLERILPFSKTLIKQHITPESIVVDATCGNGNDTLFLAEQVPEGHVYGFDIQDLALENT
                    ************************************************************

    COL             RDKVKDFNHVSLIKDGHENIEHHINDAHKGHIDAAIFNLGYLPKGDKSIVTKPDTTIQAI
    N315            RDKVKDFNHVSLIKDGHENIEHHINDAHKGHIDAAIFNLGYLPKGDKSIVTKPDTTIQAI
    NCTC8325        RDKVKDFNHVSLIKDGHENIEHHINDAHKGHIDAAIFNLGYLPKGDKSIVTKPDTTIQAI
    Newman          RDKVKDFNHVSLIKDGHENIEHHINDAHKGHIDAAIFNLGYLPKGDKSIVTKPDTTIQAI
    USA300_FPR3757  RDKVKDFNHVSLIKDGHENIEHHINDAHKGHIDAAIFNLGYLPKGDKSIVTKPDTTIQAI
                    ************************************************************

    COL             NSLLSLMSIEGIIVLVIYHGHSEGQIEKHALLDYLSTLDQKHAQVLQYQFLNQRNHAPFI
    N315            NSLLSLMSIEGIIVLVIYHGHSEGQIEKHALLDYLSTLDQKHAQVLQYQFLNQRNHAPFI
    NCTC8325        NSLLSLMSIEGIIVLVIYHGHSEGQIEKHALLDYLSTLDQKHAQVLQYQFLNQRNHAPFI
    Newman          NSLLSLMSIEGIIVLVIYHGHSEGQIEKHALLDYLSTLDQKHAQVLQYQFLNQRNHAPFI
    USA300_FPR3757  NSLLSLMSIEGIIVLVIYHGHSEGQIEKHALLDYLSTLDQKHAQVLQYQFLNQRNHAPFI
                    ************************************************************

    COL             CAIEKIS
    N315            CAIEKIS
    NCTC8325        CAIEKIS
    Newman          CAIEKIS
    USA300_FPR3757  CAIEKIS
                    *******