From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004448000
  • symbol?: rot
  • description?: repressor of toxins Rot

      descriptions from strain specific annotations:

    • repressor of toxins Rot
    • accessory regulator A-like protein
    • HTH-type transcriptional regulator rot (Repressor of toxins)
    • repressor of toxins transcriptional regulator
    • accessory regulator Rot
    • virulence factor regulator protein
    • repressor of toxins, Rot
    • HTH-type transcriptional regulator Rot
    • Staphylococcal accessory regulator
    • Toxin repressor
  • strand?: -
  • coordinates?: 4695589..4695990
  • synteny block?: BlockID0034450
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1812 (rot)
    N315:
    SA1583 (rot)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1720 (rot)
    08BA02176:
    C248_1809 (rot)
    11819-97:
    MS7_1768 (rot)
    71193:
    ST398NM01_1815
    ECT-R 2:
    ECTR2_1602
    ED133:
    SAOV_1748
    ED98:
    SAAV_1773 (rot)
    HO 5096 0412:
    SAEMRSA15_16700 (rot)
    JH1:
    SaurJH1_1852
    JH9:
    SaurJH9_1817
    JKD6008:
    SAA6008_01734 (rot)
    JKD6159:
    SAA6159_01685 (rot)
    LGA251:
    SARLGA251_16520 (rot)
    M013:
    M013TW_1778
    MRSA252:
    SAR1847 (rot)
    MSHR1132:
    SAMSHR1132_16120
    MSSA476:
    SAS1688
    Mu3:
    SAHV_1750 (rot)
    Mu50:
    SAV1764 (rot)
    MW2:
    MW1705 (rot)
    RF122:
    SAB1622c (rot)
    ST398:
    SAPIG1815
    T0131:
    SAT0131_01874
    TCH60:
    HMPREF0772_11389 (rot)
    TW20:
    SATW20_17520 (rot)
    USA300_TCH1516:
    USA300HOU_1753 (rot)
    VC40:
    SAVC_08020

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MHKLAHTSFGIVGMFVNTCIVAKYVIINWEMFSMKKVNNDTVFGILQLETLLGDINSIFS
    N315            -------------MFVNTCMVAKYVIINWEMFSMKKVNNDTVFGILQLETLLGDINSIFS
    NCTC8325        ---------------------------------MKKVNNDTVFGILQLETLLGDINSIFS
    Newman          MHKLARTSFGIVGMFVNTCIVAKYVIINWEMFSMKKVNNDTVFGILQLETLLGDINSIFS
    USA300_FPR3757  MHKLAHTSFGIVGMFVNTCIVAKYVIINWEMFSMKKVNNDTVFGILQLETLLGDINSIFS
                                                     ***************************

    COL             EIESEYKMSREEILILLTLWQKGFMTLKEMDRFVEVKPYKRTRTYNNLVELEWIYKERPV
    N315            EIESEYKMSREEILILLTLWQKGSMTLKEMDRFVEVKPYKRTRTYNNLVELEWIYKERPV
    NCTC8325        EIESEYKMSREEILILLTLWQKGSMTLKEMDRFVEVKPYKRTRTYNNLVELEWIYKERPV
    Newman          EIESEYKMSREEILILLTLWQKGSMTLKEMDRFVEVKPYKRTRTYNNLVELEWIYKERPV
    USA300_FPR3757  EIESEYKMSREEILILLTLWQKGSMTLKEMDRFVEVKPYKRTRTYNNLVELEWIYKERPV
                    *********************** ************************************

    COL             DDERTVIIHFNEKLQQEKVELLNFISDAIASRATAMQNSLNAIIAV
    N315            DDERTVIIHFNEKLQQEKVELLNFISDAIASRATAMQNSLNAIIAV
    NCTC8325        DDERTVIIHFNEKLQQEKVELLNFISDAIASRATAMQNSLNAIIAV
    Newman          DDERTVIIHFNEKLQQEKVELLNFISDAIASRATAMQNSLNAIIAV
    USA300_FPR3757  DDERTVIIHFNEKLQQEKVELLNFISDAIASRATAMQNSLNAIIAV
                    **********************************************