From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN004575000
  • symbol?: epiP
  • description?: epidermin leader peptide processing serine protease EpiP

      descriptions from strain specific annotations:

    • epidermin leader peptide processing serine protease EpiP
    • lantibiotic epidermin leader peptide processing serine protease EpiP
    • intracellular serine protease
    • lantibiotic leader peptide processing serine protease
    • lantibiotic epidermin serine protease
    • serine protease precursor
  • strand?: -
  • coordinates?: 4807226..4808599
  • synteny block?: BlockID0035600
  • occurrence?: in 44% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1874 (epiP)
    N315:
    NCTC8325:
    Newman:
    NWMN_1712 (bsaP)
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    MS7_1819 (epiP)
    71193:
    ECT-R 2:
    ED133:
    SAOV_1803
    ED98:
    HO 5096 0412:
    JH1:
    JH9:
    JKD6008:
    JKD6159:
    LGA251:
    SARLGA251_17020
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS1742
    Mu3:
    Mu50:
    MW2:
    MW1761 (bsaP)
    RF122:
    SAB1679c
    ST398:
    T0131:
    SAT0131_01940
    TCH60:
    TW20:
    SATW20_18160
    USA300_TCH1516:
    USA300HOU_1811 (epiP)
    VC40:
    SAVC_08330

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKIIKRAIISLIILSLLISITMSNASASEELYYSVEYKNTATFNKLVKKKSLNVVYNIPE
    NCTC8325        MKIIKRAIISLIILSLLISITMSNASASEELYYSVEYKNTATFNKLVKKKSLNVVYNIPE
    Newman          MKIIKRAIISLIILSLLISITMSNASASEELYYSVEYKNTATFNKLVKKKSLNVVYNIPE
    USA300_FPR3757  MKIIKRAIISLIILSLLISITMSNASASEELYYSVEYKNTATFNKLVKKKSLNVVYNIPE
                    ************************************************************

    COL             LHVAQIKMTKMHANALANYKNDIKYINATCSTCITSEKTIDRTSNESLFSRQWDMNKITN
    NCTC8325        LHVAQIKMTKMHANALANYKNDIKYINATCSTCITSEKTIDRTSNESLFSRQWDMNKITN
    Newman          LHVAQIKMTKMHANALANYKNDIKYINATCSTCITSEKTIDRTSNESLFSRQWDMNKITN
    USA300_FPR3757  LHVAQIKMTKMHANALANYKNDIKYINATCSTCITSEKTIDRTSNESLFSRQWDMNKITN
                    ************************************************************

    COL             NGASYDDLPKHANTKIAIIDTGVMKNHDDLKNNFSTDSKNLVPLNGFRGTEPEETGDVHD
    NCTC8325        NGASYDDLPKHANTKIAIIDTGVMKNHDDLKNNFSTDSKNLVPLNGFRGTEPEETGDVHD
    Newman          NGASYDDLPKHANTKIAIIDTGVMKNHDDLKNNFSTDSKNLVPLNGFRGTEPEETGDVHD
    USA300_FPR3757  NGASYDDLPKHANTKIAIIDTGVMKNHDDLKNNFSTDSKNLVPLNGFRGTEPEETGDVHD
                    ************************************************************

    COL             VNDRKGHGTMVSGQTSANGKLIGVAPNNKFTMYRVFGSKKTELLWVSKAIVQAANDGNQV
    NCTC8325        VNDRKGHGTMVSGQTSANGKLIGVAPNNKFTMYRVFGSKKTELLWVSKAIVQAANDGNQV
    Newman          VNDRKGHGTMVSGQTSANGKLIGVAPNNKFTMYRVFGSKKTELLWVSKAIVQAANDGNQV
    USA300_FPR3757  VNDRKGHGTMVSGQTSANGKLIGVAPNNKFTMYRVFGSKKTELLWVSKAIVQAANDGNQV
                    ************************************************************

    COL             INISVGSYIILDKNDHQTFRKDEKVEYDALQKAINYAKKKKSIVVAAAGNDGIDVNDKQK
    NCTC8325        INISVGSYIILDKNDHQTFRKDEKVEYDALQKAINYAKKKKSIVVAAAGNDGIDVNDKQK
    Newman          INISVGSYIILDKNDHQTFRKDEKVEYDALQKAINYAKKKKSIVVAAAGNDGIDVNDKQK
    USA300_FPR3757  INISVGSYIILDKNDHQTFRKDEKVEYDALQKAINYAKKKKSIVVAAAGNDGIDVNDKQK
                    ************************************************************

    COL             LKLQREYQGNGEVKDVPASMDNVVTVGSTDQKSNLSEFSNFGMNYTDIAAPGGSFAYLNQ
    NCTC8325        LKLQREYQGNGEVKDVPASMDNVVTVGSTDQKSNLSEFSNFGMNYTDIAAPGGSFAYLNQ
    Newman          LKLQREYQGNGEVKDVPASMDNVVTVGSTDQKSNLSEFSNFGMNYTDIAAPGGSFAYLNQ
    USA300_FPR3757  LKLQREYQGNGEVKDVPASMDNVVTVGSTDQKSNLSEFSNFGMNYTDIAAPGGSFAYLNQ
                    ************************************************************

    COL             FGVDKWMNEGYMHKENILTTANNGRYIYQAGTSLATPKVSGALALIIDKYHLEKHPDKAI
    NCTC8325        FGVDKWMNEGYMHKENILTTANNGRYIYQAGTSLATPKVSGALALIIDKYHLEKHPDKAI
    Newman          FGVDKWMNEGYMHKENILTTANNGRYIYQAGTSLATPKVSGALALIIDKYHLEKHPDKAI
    USA300_FPR3757  FGVDKWMNEGYMHKENILTTANNGRYIYQAGTSLATPKVSGALALIIDKYHLEKHPDKAI
                    ************************************************************

    COL             ELLYQHGTSKNNKPFSRYGHGELDVYKALNVANQKAS
    NCTC8325        ELLYQHGTSKNNKPFSRYGHGELDVYKALNVANQKAS
    Newman          ELLYQHGTSKNNKPFSRYGHGELDVYKALNVANQKAS
    USA300_FPR3757  ELLYQHGTSKNNKPFSRYGHGELDVYKALNVANQKAS
                    *************************************