From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004774000
  • symbol?:
  • description?: DNA repair exonuclease

      descriptions from strain specific annotations:

    • DNA repair exonuclease
    • metallophosphoesterase
    • calcineurin-like phosphoesterase
    • calcineurin-like phosphoesterase family protein
    • DNA repair exonuclease family protein
    • DNA repair exonuclease family protein YhaO
    • phosphoesterase
    • putative DNA repair exonuclease
    • Ser/Thr protein phosphatase family protein
  • strand?: -
  • coordinates?: 4984483..4985679
  • synteny block?: BlockID0037060
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1800 (yhaO)
    08BA02176:
    C248_1886
    11819-97:
    MS7_1849
    71193:
    ST398NM01_1910
    ECT-R 2:
    ECTR2_1686
    ED133:
    SAOV_1840
    ED98:
    SAAV_1863
    HO 5096 0412:
    SAEMRSA15_17490
    JH1:
    SaurJH1_1931
    JH9:
    SaurJH9_1897
    JKD6008:
    SAA6008_01801
    JKD6159:
    SAA6159_01772
    LGA251:
    SARLGA251_17270
    M013:
    M013TW_1850
    MRSA252:
    SAR1935
    MSHR1132:
    SAMSHR1132_16900
    MSSA476:
    SAS1765
    Mu3:
    SAHV_1829
    Mu50:
    SAV1844
    MW2:
    MW1785
    RF122:
    SAB1777c
    ST398:
    SAPIG1910
    T0131:
    SAT0131_01964 (nrdI)
    TCH60:
    HMPREF0772_11300
    TW20:
    SATW20_18380
    USA300_TCH1516:
    USA300HOU_1836 (sbcD)
    VC40:
    SAVC_08460

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVKFIHCSDLHLDSPFKSKSHISPKIFEDVQKSAYESFKNIVDIALQQDVDFVIIAGDLF
    N315            MVKFIHCSDLHLDSPFKSKSHISPKIFEDVQKSAYESFKNIVDIALQQDVDFVIIAGDLF
    NCTC8325        MVKFIHCSDLHLDSPFKSKSHISPKIFEDVQKSAYESFKNIVDIALQQDVDFVIIAGDLF
    Newman          MVKFIHCSDLHLDSPFKSKSHISPKIFEDVQKSAYESFKNIVDIALQQDVDFVIIAGDLF
    USA300_FPR3757  MVKFIHCSDLHLDSPFKSKSHISPKIFEDVQKSAYESFKNIVDIALQQDVDFVIIAGDLF
                    ************************************************************

    COL             DSENRTLRAEIFLKQQFERLQNEQIFVYVCHGNHDPLSSKISSNWPDNVSVFSNKVETYE
    N315            DSENRTLRAEIFLKQQFERLQNEQIFVYVCHGNHDPLSSKISSNWPDNVSVFSNKVETYE
    NCTC8325        DSENRTLRAEIFLKQQFERLQNEQIFVYVCHGNHDPLSSKISSNWPDNVSVFSNKVETYE
    Newman          DSENRTLRAEIFLKQQFERLQNEQIFVYVCHGNHDPLSSKISSNWPDNVSVFSNKVETYE
    USA300_FPR3757  DSENRTLRAEIFLKQQFERLQNEQIFVYVCHGNHDPLSSKISSNWPDNVSVFSNKVETYE
                    ************************************************************

    COL             AITKSGETIYIHGFSYENRASYENKIDEYPSSQGQKGIHIGVLHGTYSKSSVNERYTEFI
    N315            AITKSGETIYIHGFSYENRASYENKIDEYPSSQGQKGIHIGVLHGTYSKSSVNERYTEFI
    NCTC8325        AITKSGETIYIHGFSYENRASYENKIDEYPSSQGQKGIHIGVLHGTYSKSSVNERYTEFI
    Newman          AITKSGETIYIHGFSYENRASYENKIDEYPSSQGQKGIHIGVLHGTYSKSSVNERYTEFI
    USA300_FPR3757  AITKSGETIYIHGFSYENRASYENKIDEYPSSQGQKGIHIGVLHGTYSKSSVNERYTEFI
                    ************************************************************

    COL             LEDLNSKLYHYWALGHIHERQQLSDMPVINYSGNIQGRHFNEQGEKGCLLIEGDHLKLKT
    N315            LEDLNSKLYHYWALGHIHERQQLSDMPVINYSGNIQGRHFNEQGEKGCLLIEGDHLKLKT
    NCTC8325        LEDLNSKLYHYWALGHIHERQQLSDMPVINYSGNIQGRHFNEQGEKGCLLIEGDHLKLKT
    Newman          LEDLNSKLYHYWALGHIHERQQLSDMPVINYSGNIQGRHFNEQGEKGCLLIEGDHLKLKT
    USA300_FPR3757  LEDLNSKLYHYWALGHIHERQQLSDMPVINYSGNIQGRHFNEQGEKGCLLIEGDHLKLKT
                    ************************************************************

    COL             KFYPTQYIRFEEATIETDKTSKQGLYEVIQNFKEQVREEGKAFYRLTLVINSETLISPQD
    N315            KFYPTQYIRFEEATIETDKTSKQGLYEVIQNFKEQVREEGKAFYRLTLVINSETLISPQD
    NCTC8325        KFYPTQYIRFEEATIETDKTSKQGLYEVIQNFKEQVREEGKAFYRLTLVINSETLISPQD
    Newman          KFYPTQYIRFEEATIETDKTSKQGLYEVIQNFKEQVREEGKAFYRLTLVINSETLISPQD
    USA300_FPR3757  KFYPTQYIRFEEATIETDKTSKQGLYEVIQNFKEQVREEGKAFYRLTLVINSETLISPQD
                    ************************************************************

    COL             LLQVEEMITDYEENENQFVYIDELKIQYAQNDESPLVNEFSAELLVDQTVFDKAMSDLYL
    N315            LLQVEEMITDYEENENQFVYIDELKIQYAQNDESPLVNEFSAELLVDQTVFDKAMSDLYL
    NCTC8325        LLQVEEMITDYEENENQFVYIDELKIQYAQNDESPLVNEFSAELLVDQTVFDKAMSDLYL
    Newman          LLQVEEMITDYEENENQFVYIDELKIQYAQNDESPLVNEFSAELLVDQTVFDKAMSDLYL
    USA300_FPR3757  LLQVEEMITDYEENENQFVYIDELKIQYAQNDESPLVNEFSAELLVDQTVFDKAMSDLYL
                    ************************************************************

    COL             NPRASKFLDDYGTFDHTALVNRAEEILKAEMRGEQNDN
    N315            NPRASKFLDDYGTFDHTALVNRAEEILKAEMRGEQNDN
    NCTC8325        NPRASKFLDDYGTFDHTALVNRAEEILKAEMRGEQNDN
    Newman          NPRASKFLDDYGTFDHTALVNRAEEILKAEMRGEQNDN
    USA300_FPR3757  NPRASKFLDDYGTFDHTALVNRAEEILKAEMRGEQNDN
                    **************************************