From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004792000
  • symbol?: queG
  • description?: (Fe-S)-binding protein

      descriptions from strain specific annotations:

    • (Fe-S)-binding protein
    • iron-sulfur cluster binding protein
    • putative iron-sulfur cluster-binding protein
    • iron-sulfur (Fe-S) cluster-binding protein
    • putative iron-sulfur protein
    • phenylalanyl-tRNA synthetase subunit alpha
    • iron-sulfur binding protein
    • iron-sulfur cluster binding protein, putative
  • strand?: -
  • coordinates?: 4999079..5000209
  • synteny block?: BlockID0037240
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1812
    08BA02176:
    C248_1900
    11819-97:
    MS7_1861
    71193:
    ST398NM01_1922
    ECT-R 2:
    ECTR2_1698
    ED133:
    SAOV_1853
    ED98:
    SAAV_1875
    HO 5096 0412:
    SAEMRSA15_17610
    JH1:
    SaurJH1_1944
    JH9:
    SaurJH9_1910
    JKD6008:
    SAA6008_01813
    JKD6159:
    SAA6159_01785
    LGA251:
    SARLGA251_17390
    M013:
    M013TW_1862
    MRSA252:
    SAR1947
    MSHR1132:
    SAMSHR1132_17020
    MSSA476:
    SAS1779
    Mu3:
    SAHV_1841
    Mu50:
    SAV1856
    MW2:
    MW1797
    RF122:
    SAB1790c
    ST398:
    SAPIG1922
    T0131:
    SAT0131_01976
    TCH60:
    HMPREF0772_11288
    TW20:
    SATW20_18500
    USA300_TCH1516:
    USA300HOU_1851
    VC40:
    SAVC_08530

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -----MDTKQLKQDIIDYAYTIGIDSIGFTTADPFDELKQKLEAYHANGYASGFEESDIA
    N315            -----MDTKQLKQDIIDYAYTIGIDSIGFTTADPFDELKQKLEAYHANGYASGFEESDIA
    NCTC8325        MGGIRLDTKQLKQDIIDYAYTIGIDSIGFTTADPFDELKQKLEAYHANGYASGFEESDIA
    Newman          -----MDTKQLKQDIIDYAYTIGIDSIGFTTADPFDELKQKLEAYHANGYASGFEESDIA
    USA300_FPR3757  -----MDTKQLKQDIIDYAYTIGIDSIGFTTADPFDELKQKLEAYHANGYASGFEESDIA
                         :******************************************************

    COL             LRTEPKLSLPTARSIIAIAVGYPNKLKGAPKSVRGDRRGLFARASWGQDYHTIMRKRLDM
    N315            LRTEPKLSLPTARSIIAIAVGYPNKLKGAPKSVRGDRRGLFARASWGQDYHTIMRKRLDM
    NCTC8325        LRTEPKLSLPTARSIIAIAVGYPNKLKGAPKSVRGDRRGLFARASWGQDYHTIMRKRLDM
    Newman          LRTEPKLSLPTARSIIAIAVGYPNKLKGAPKSVRGDRRGLFARASWGQDYHTIMRKRLDM
    USA300_FPR3757  LRTEPKLSLPTARSIIAIAVGYPNKLKGAPKSVRGDRRGLFARASWGQDYHTIMRKRLDM
                    ************************************************************

    COL             LAAFIESKVPDVEIKSMVDTGVLSDRAVAERAGLGFVGRNGFVINPKLGTWTYLGEMLVS
    N315            LAAFIESKVPDVEIKSMVDTGVLSDRAVAERAGLGFVGRNGFVINPKLGTWTYLGEMLVS
    NCTC8325        LAAFIESKVPDVEIKSMVDTGVLSDRAVAERAGLGFVGRNGFVINPKLGTWTYLGEMLVS
    Newman          LAAFIESKVPDVEIKSMVDTGVLSDRAVAERAGLGFVGRNGFVINPKLGTWTYLGEMLVS
    USA300_FPR3757  LAAFIESKVPDVEIKSMVDTGVLSDRAVAERAGLGFVGRNGFVINPKLGTWTYLGEMLVS
                    ************************************************************

    COL             IPFEPDDPLLDSCGDCTICVDRCPTSALVGNGQLNSQKCISFLTQTKGYMPDQYRYKIGN
    N315            IPFEPDDPLLDSCGDCTICVDRCPTSALVGNGQLNSQKCISFLTQTKGYMPDQYRYKIGN
    NCTC8325        IPFEPDDPLLDSCGDCTICVDRCPTSALVGNGQLNSQKCISFLTQTKGYMPDQYRYKIGN
    Newman          IPFEPDDPLLDSCGDCTICVDRCPTSALVGNGQLNSQKCISFLTQTKGYMPDQYRYKIGN
    USA300_FPR3757  IPFEPDDPLLDSCGDCTICVDRCPTSALVGNGQLNSQKCISFLTQTKGYMPDQYRYKIGN
                    ************************************************************

    COL             RLYGCDTCQQVCPKNRGINTEQDDIILEPEILKPRLVPLLRMSNKEFKQTYGHLAGAWRG
    N315            RLYGCDTCQQVCPKNRGINTEQDDIILEPEILKPRLVPLLRMSNKEFKQTYGHLAGAWRG
    NCTC8325        RLYGCDTCQQVCPKNRGINTEQDDIILEPEILKPRLVPLLRMSNKEFKQTYGHLAGAWRG
    Newman          RLYGCDTCQQVCPKNRGINTEQDDIILEPEILKPRLVPLLRMSNKEFKQTYGHLAGAWRG
    USA300_FPR3757  RLYGCDTCQQVCPKNRGINTEQDDIILEPEILKPRLVPLLRMSNKEFKQTYGHLAGAWRG
                    ************************************************************

    COL             KKPIQRNAILALAHFNEVDAIPELKKVATTDERPLIRATAYWAIGQILGEEARDFINANY
    N315            KKPIQRNAILALAHFNEVDAIPELKKVATTDERPMIRATAYWAIGQILGEEARDFINANY
    NCTC8325        KKPIQRNAILALAHFNEVDAIPELKKVATTDERPLIRATAYWAIGQILGEEARDFINANY
    Newman          KKPIQRNAILALAHFNEVDAIPELKKVATTDERPLIRATAYWAIGQILGEEARDFINANY
    USA300_FPR3757  KKPIQRNAILALAHFNEVDAIPELKKVATTDERPLIRATAYWAIGQILGEEARDFINANY
                    **********************************:*************************

    COL             DQEDAEVQNEMIKGLDTRRE
    N315            DQEDAEVQNEMIKGLDTRRE
    NCTC8325        DQEDAEVQNEMIKGLDTRRE
    Newman          DQEDAEVQNEMIKGLDTRRE
    USA300_FPR3757  DQEDAEVQNEMIKGLDTRRE
                    ********************