From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004850000
  • symbol?: mutY
  • description?: A/G-specific adenine glycosylase

      descriptions from strain specific annotations:

    • A/G-specific adenine glycosylase
    • HhH-GPD superfamily base excision DNA repairprotein
    • A/G-specific adenine glycosylase DNA repair protein
    • A/G-specific DNA glycosylase
  • strand?: -
  • coordinates?: 5056921..5057959
  • synteny block?: BlockID0037800
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1926 (mutY)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1824
    08BA02176:
    C248_1939
    11819-97:
    MS7_1903 (mutY)
    71193:
    ST398NM01_1961
    ECT-R 2:
    ECTR2_1739 (mutY)
    ED133:
    SAOV_1895
    ED98:
    SAAV_1918 (mutY)
    HO 5096 0412:
    SAEMRSA15_17750
    JH1:
    SaurJH1_1956
    JH9:
    SaurJH9_1922
    JKD6008:
    SAA6008_01825 (mutY)
    JKD6159:
    SAA6159_01799 (mutY)
    LGA251:
    SARLGA251_17500
    M013:
    M013TW_1904
    MRSA252:
    SAR1958
    MSHR1132:
    SAMSHR1132_17130
    MSSA476:
    SAS1790
    Mu3:
    SAHV_1853
    Mu50:
    SAV1868
    MW2:
    MW1808
    RF122:
    SAB1801c
    ST398:
    SAPIG1961 (mutY)
    T0131:
    SAT0131_01990
    TCH60:
    HMPREF0772_11276 (mutY)
    TW20:
    SATW20_18620
    USA300_TCH1516:
    USA300HOU_1863 (mutY)
    VC40:
    SAVC_08595

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYQQSSFKENLIHWFDENQREMPWRQTTNPYYIWLSEVMLQQTQVKTVIDYYHRFVERFP
    N315            MYQQSSFKENLIHWFDENQREMPWRQTTNPYYIWLSEVMLQQTQVKTVIDYYHRFVERFP
    NCTC8325        MYQQSSFKENLIHWFDENQREMPWRQTTNPYYIWLSEVMLQQTQVKTVIDYYHRFVERFP
    Newman          MYQQSSFKENLIHWFDENQREMPWRQTTNPYYIWLSEVMLQQTQVKTVIDYYHRFVERFP
    USA300_FPR3757  MYQQSSFKENLIHWFDENQREMPWRQTTNPYYIWLSEVMLQQTQVKTVIDYYHRFVERFP
                    ************************************************************

    COL             TVEVLSQASEDEVLKYWEGLGYYSRARNFHTAIKEVHDKYEGLVPKDPDQFKALKGVGPY
    N315            TVEVLSQASEDEVLKYWEGLGYYSRARNFHTAIKEVYDKYEGLVPKDPDQFKALKGVGPY
    NCTC8325        TVEVLSQASEDEVLKYWEGLGYYSRARNFHTAIKEVHDKYEGLVPKDPDQFKALKGVGPY
    Newman          TVEVLSQASEDEVLKYWEGLGYYSRARNFHTAIKEVHDKYEGLVPKDPDQFKALKGVGPY
    USA300_FPR3757  TVEVLSQASEDEVLKYWEGLGYYSRARNFHTAIKEVHDKYEGLVPKDPDQFKALKGVGPY
                    ************************************:***********************

    COL             TQAAVMSIAYNVPLATVDGNVFRVWSRLNDDYRDIKLQSTRKSYEQELLPYVTTEAGTFN
    N315            TQAAVMSIAYNVPLATVDGNVFRVWSRLNDDYRDIKLQSTRKSYEQELLPYVTTEAGTFN
    NCTC8325        TQAAVMSIAYNVPLATVDGNVFRVWSRLNDDYRDIKLQSTRKSYEQELLPYVTTEAGTFN
    Newman          TQAAVMSIAYNVPLATVDGNVFRVWSRLNDDYRDIKLQSTRKSYEQELLPYVTTEAGTFN
    USA300_FPR3757  TQAAVMSIAYNVPLATVDGNVFRVWSRLNDDYRDIKLQSTRKSYEQELLPYVTTEAGTFN
                    ************************************************************

    COL             QAMMELGALICTPKNPLCLFCPVQENCEAFDKGTFEKLPVKSKNVSKKVIEQSVFLIRNN
    N315            QAMMELGALICTPKNPLCLFCPVQENCEAFDKGTFEKLPVKSKNVSKKVIEQSVFLIRNN
    NCTC8325        QAMMELGALICTPKNPLCLFCPVQENCEAFDKGTFEKLPVKSKNVSKKVIEQSVFLIRNN
    Newman          QAMMELGALICTPKNPLCLFCPVQENCEAFDKGTFEKLPVKSKNVSKKVIEQSVFLIRNN
    USA300_FPR3757  QAMMELGALICTPKNPLCLFCPVQENCEAFDKGTFEKLPVKSKNVSKKVIEQSVFLIRNN
                    ************************************************************

    COL             QGQYLLQKRSEKLLHGMWQFPMFESEHARRKMTEKIGHDIQPVETPIFELKHQFTHLTWK
    N315            QGQYLLQKRSEKLLHGMWQFPMFESEHARRKMTEKIGHDIQPVETPIFELKHQFTHLTWK
    NCTC8325        QGQYLLQKRSEKLLHGMWQFPMFESEHARRKMTEKIGHDIQPVETPIFELKHQFTHLTWK
    Newman          QGQYLLQKRSEKLLHGMWQFPMFESEHARRKMTEKIGHDIQPVETPIFELKHQFTHLTWK
    USA300_FPR3757  QGQYLLQKRSEKLLHGMWQFPMFESEHARRKMTEKIGHDIQPVETPIFELKHQFTHLTWK
                    ************************************************************

    COL             IKVYAVSGAINIETLPDDMIWFDLSDRDQYTFPVPMSKIYQFING
    N315            IKVYAASGAINIETLPDDMIWFNLSDRDQYTFPVPMSKIYQFING
    NCTC8325        IKVYAVSGAINIETLPDDMIWFDLSDRDQYTFPVPMSKIYQFING
    Newman          IKVYAVSGAINIETLPDDMIWFDLSDRDQYTFPVPMSKIYQFING
    USA300_FPR3757  IKVYAVSGAINIETLPDDMIWFDLSDRDQYTFPVPMSKIYQFING
                    *****.****************:**********************