From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004956000
  • symbol?: aldH
  • description?: aldehyde dehydrogenase

      descriptions from strain specific annotations:

    • aldehyde dehydrogenase
    • putative aldehyde dehydrogenase ywdH
    • fatty aldehyde dehydrogenase (Aldehyde dehydrogenase,microsomal) (Aldehyde dehydrogenase family 3 member A2) (Aldehydedehydrogenase 10)
    • aldehyde dehydrogenase (NAD(P)+)
    • aldehyde dehydrogenase family protein
  • strand?: +
  • coordinates?: 5144129..5145508
  • synteny block?: BlockID0038600
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1984 (aldA2)
    N315:
    SA1736 (aldH)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    SAUSA300_1901 (aldA2)
    04-02981:
    SA2981_1878 (aldH)
    08BA02176:
    C248_1998
    11819-97:
    MS7_1956
    71193:
    ST398NM01_2015
    ECT-R 2:
    ECTR2_1793
    ED133:
    SAOV_2023
    ED98:
    SAAV_1988 (aldA2)
    HO 5096 0412:
    SAEMRSA15_18300
    JH1:
    SaurJH1_2010
    JH9:
    SaurJH9_1977
    JKD6008:
    SAA6008_01942 (aldH)
    JKD6159:
    SAA6159_01852 (aldH)
    LGA251:
    SARLGA251_18050
    M013:
    M013TW_1958
    MRSA252:
    SAR2013
    MSHR1132:
    SAMSHR1132_17650
    MSSA476:
    SAS1844
    Mu3:
    SAHV_1905 (aldH)
    Mu50:
    SAV1920 (aldH)
    MW2:
    MW1861 (aldH)
    RF122:
    SAB1857
    ST398:
    SAPIG2015
    T0131:
    SAT0131_02050
    TCH60:
    HMPREF0772_11220 (aldA2)
    TW20:
    SATW20_19150
    USA300_TCH1516:
    USA300HOU_1923 (aldH1)
    VC40:
    SAVC_08865

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNIIEQKFYDSKAFFNTQQTKDISFRKEQLKKLSKAIKSYESDILEALYTDLGKNKVEAY
    N315            MNIIEQKFYDSKAFFNTQQTKDISFRKDQLKKLSKAIKSYESDILEALYTDLGKNKVEAY
    NCTC8325        MNIIEQKFYDSKAFFNTQQTKDISFRKEQLKKLSKAIKSYESDILEALYTDLGKNKVEAY
    Newman          MNIIEQKFYDSKAFFNTQQTKDISFRKEQLKKLSKAIKSYESDILEALYTDLGKNKVEAY
    USA300_FPR3757  MNIIEQKFYDSKAFFNTQQTKDISFRKEQLKKLSKAIKSYESDILEALYTDLGKNKVEAY
                    ***************************:********************************

    COL             ATEIGITLKSIKIARKELKNWTKTKNVDTPLYLFPTKSYIKKEPYGTVLIIAPFNYPFQL
    N315            ATEIGITLKSIKNARKELKNWTKTKNVDTPLYLFPTKSYIKKEPYGTVLIIAPFNYPFQL
    NCTC8325        ATEIGITLKSIKIARKELKNWTKTKNVDTPLYLFPTKSYIKKEPYGTVLIIAPFNYPFQL
    Newman          ATEIGITLKSIKIARKELKNWTKTKNVDTPLYLFPTKSYIKKEPYGTVLIIAPFNYPFQL
    USA300_FPR3757  ATEIGITLKSIKIARKELKNWTKTKNVDTPLYLFPTKSYIKKEPYGTVLIIAPFNYPFQL
                    ************ ***********************************************

    COL             VFEPLIGAIAAGNTAIIKPSELTPNVARVIKRLINETFDANYIEVIEGGIEETQTLIHLP
    N315            VFEPLIGAIAAGNTAIIKPSELTPNVARVIKRLINETFDANYIEVIEGGIEETQTLIHLP
    NCTC8325        VFEPLIGAIAAGNTAIIKPSELTPNVARVIKRLINETFDANYIEVIEGGIEETQTLIHLP
    Newman          VFEPLIGAIAAGNTAIIKPSELTPNVARVIKRLINETFDANYIEVIEGGIEETQTLIHLP
    USA300_FPR3757  VFEPLIGAIAAGNTAIIKPSELTPNVARVIKRLINETFDANYIEVIEGGIEETQTLIHLP
                    ************************************************************

    COL             FDYVFFTGSENVGKIVYQAASENLVPVTLEMGGKSPVIVDETANIKVASERICFGKFTNA
    N315            FDYVFFTGSENVGKIVYQAASENLVPVTLEMGGKSPVIVDETANIKVASERICFGKFTNA
    NCTC8325        FDYVFFTGSENVGKIVYQAASENLVPVTLEMGGKSPVIVDETANIKVASERICFGKFTNA
    Newman          FDYVFFTGSENVGKIVYQAASENLVPVTLEMGGKSPVIVDETANIKVASERICFGKFTNA
    USA300_FPR3757  FDYVFFTGSENVGKIVYQAASENLVPVTLEMGGKSPVIVDETANIKVASERICFGKFTNA
                    ************************************************************

    COL             GQTCVAPDYILVHESVKDDLITALSKTLREFYGQNIQQSPDYGRIVNLKHYHRLTSLLNS
    N315            GQTCVAPDYILVHESVKDDLITALSKTLREFYGQNIQQSPDYGRIVNLKHYHRLTSLLNS
    NCTC8325        GQTCVAPDYILVHESVKDDLITALSKTLREFYGQNIQQSPDYGRIVNLKHYHRLTSLLNS
    Newman          GQTCVAPDYILVHESVKDDLITALSKTLREFYGQNIQQSPDYGRIVNLKHYHRLTSLLNS
    USA300_FPR3757  GQTCVAPDYILVHESVKDDLITALSKTLREFYGQNIQQSPDYGRIVNLKHYHRLTSLLNS
                    ************************************************************

    COL             AQMNIVFGGHSDEDERYIEPTLLDHVTSDSAIMQEEIFGPILPILTYQSLDEAIAFIHQR
    N315            AQMNIVFGGHSDEDERYIEPTLLDHVTSDSAIMQEEIFGPILPILTYQSLDEAIAFIHQR
    NCTC8325        AQMNIVFGGHSDEDERYIEPTLLDHVTSDSAIMQEEIFGPILPILTYQSLDEAIAFIHQR
    Newman          AQMNIVFGGHSDEDERYIEPTLLDHVTSDSAIMQEEIFGPILPILTYQSLDEAIAFIHQR
    USA300_FPR3757  AQMNIVFGGHSDEDERYIEPTLLDHVTSDSAIMQEEIFGPILPILTYQSLDEAIAFIHQR
                    ************************************************************

    COL             PKPLSLYLFSEDENATQRVINELSFGGGAINDTLMHLANPKLPFGGVGASGMGRYHGKYS
    N315            PKPLSLYLFSEDENATQRVINELSFGGGAINDTLMHLANPKLPFGGVGASGMGRYHGKYS
    NCTC8325        PKPLSLYLFSEDENATQRVINELSFGGGAINDTLMHLANPKLPFGGVGASGMGRYHGKYS
    Newman          PKPLSLYLFSEDENATQRVINELSFGGGAINDTLMHLANPKLPFGGVGASGMGRYHGKYS
    USA300_FPR3757  PKPLSLYLFSEDENATQRVINELSFGGGAINDTLMHLANPKLPFGGVGASGMGRYHGKYS
                    ************************************************************

    COL             FDTFTHEKSYIFKSTRLESGVHLPPYKGKFKYIKAFFKN
    N315            FDTFTHEKSYIFKSTRLESGVHLPPYKGKFKYIKAFFKN
    NCTC8325        FDTFTHEKSYIFKSTRLESGVHLPPYKGKFKYIKAFFKN
    Newman          FDTFTHEKSYIFKSTRLESGVHLPPYKGKFKYIKAFFKN
    USA300_FPR3757  FDTFTHEKSYIFKSTRLESGVHLPPYKGKFKYIKAFFKN
                    ***************************************