From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005048000
  • symbol?:
  • description?: phi PVL ORF 15 and 16-like protein

      descriptions from strain specific annotations:

    • phi PVL ORF 15 and 16-like protein
    • phi PVL ORF 15 and 16 homologue
    • phage tail length tape measure protein
    • Phi PVL hypothetical protein
    • pseudogene
    • phi77 ORF001-like protein, phage tail tape measure protein
    • bacteriophage tail length tape measure protein
    • TP901 family phage tail tape measure protein
    • phage tail tape measure protein, TP901 family, core region
  • strand?: -
  • coordinates?: 5210908..5218102
  • synteny block?: BlockID0039260
  • occurrence?: in 56% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1916
    08BA02176:
    11819-97:
    71193:
    ST398NM01_2919
    ECT-R 2:
    ECTR2_1827
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_18700
    JH1:
    SaurJH1_2046
    JH9:
    SaurJH9_2010
    JKD6008:
    SAA6008_02009
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR2050
    MSHR1132:
    SAMSHR1132_17950
    MSSA476:
    Mu3:
    SAHV_1941
    Mu50:
    SAV1955
    MW2:
    RF122:
    ST398:
    T0131:
    SAT0131_02088 (cspC)
    TCH60:
    HMPREF0772_11186
    TW20:
    SATW20_19470
    USA300_TCH1516:
    USA300HOU_1959
    VC40:

Genome Viewer[edit source | edit]

N315 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MGERIKGLSIGLDLDAANLNRSFAEIKRNFKTLNSDLKLTGNNFKYTEKSTHSYKQRIKE
    Newman          MGERIKGLSIGLDLDAANLNRSFAEIKRNFKTLNSDLKLTGNNFKYTEKSTHSYKQRIKE
    USA300_FPR3757  MGERIKGLSIGLDLDAANLNRSFAEIKRNFKTLNSDLKLTGNNFKYTEKSTDSYKQRIKE
                    ***************************************************.********

    N315            LDGTITGYKKNVDDLAKQYGKVSQEQGENSAEAQKLRQEYNKQANELNFLEKELEKTTTE
    Newman          LDGTITGYKKNVDDLAKQYGKVSQEQGENSAEAQKLRQEYNKQANELNFLEKELEKTTTE
    USA300_FPR3757  LDGTITGYKKNVDDLAKQYDKVSQEQGENSAGAQKLRQEYNKQANELNYLERELQKTSAE
                    *******************.*********** ****************:**:**:**::*

    N315            FEEFKKAQVEAQRMAESGWGKTSKVFESMGPKLTKMGDGLKSIGKGLMIGVTAPVLGIAA
    Newman          FEEFKKAQVEAQRMAESGWGKTSKVFESMGPKLTKMGDGLKSIGKGLMIGVTAPVLGIAA
    USA300_FPR3757  FEEFKKAQVEAQRMAESGWGKTSKVFESMGPKLTKMGDGLKSIGKGMMIGVTAPVLGIAA
                    **********************************************:*************

    N315            ASGKAFAEVDKGLDTVTQATGATGGELKKLQNSFKDVYGNFPEDAETVGGVLGEVNTRLG
    Newman          ASGKAFAEVDKGLDTVTQATGATGGELKKLQNSFKDVYGNFPADAETVGGVLGEVNTRLG
    USA300_FPR3757  ASGKAFAEVDKGLDTVTQATGATGSELKKLQNSFKDVYGNFPADAETVGGVLGEVNTRLG
                    ************************.***************** *****************

    N315            FTGKELESATESFLKFSHITGSDGVQAVQLITRAMGDAGIEADEYQSVLDMVAKAAQASG
    Newman          FTGKELESATESFLKFSHITGSDGVQAVQLITRAMGDAGIEADEYQSVLDMVAKAAQASG
    USA300_FPR3757  FTGKELENATESFLKFSHITGSDGVQAVQLITRAMGDAGIEASEYQSVLDMVAKAAQASG
                    *******.**********************************.*****************

    N315            ISVDTLADSITKYGAPMRAMGFEMKESIALFSQWEKSGVNTEIAFSGLKKAISNWGKAGK
    Newman          ISVDTLADSITKYGAPMRAMGFEMKESIALFSQWEKSGVNTEIAFSGLKKAISNWGKAGK
    USA300_FPR3757  ISVDTLADSITKYGAPMRAMGFEMKESIALFSQWEKSGVNTEIAFSGLKKAISNWGKAGK
                    ************************************************************

    N315            DPREEFKKTLAEIERTPDIASATSLAIEAFGAKAGPDLADAIKGGRFSYQEFLKTIEDSQ
    Newman          DPREEFKKTLAEIERTPDIASATSLAIEAFGAKAGPDLADAIKGGRFSYQEFLKTIEDSQ
    USA300_FPR3757  NPREEFKKTLAEIEKTPDIASATILAIEAFGAKAGPDLADAIKGGRFSYQEFLKTIEDSQ
                    :*************:******** ************************************

    N315            GTVNQTFKDSESGSERFKVAMNKLKLVGADVWASIESAFAPVMEELIKKLSVAVDWFSSL
    Newman          GTVNQTFKDSESGSERFKVAMNKLKLVGADVWASIESAFAPVMEELIKKLSVAVDWFSSL
    USA300_FPR3757  GTVNQTFKDSESGSERFKVAMNKLKLVGADVWASIESAFAPVMEELIKKLSVAVDWFSNL
                    **********************************************************.*

    N315            SDGSKRSIVIFGGIAAAIGPVVFGLGAFISTVGNAVTVLAPLLASIAKAGGLISFLSTKV
    Newman          SDGSKRSIVIFGGIAAAIGPVVFGLGAFISTIGNAVTVLAPLLASIVKAGGLISFLSTKV
    USA300_FPR3757  SDGSKRSIVIFGGIAAAIGPVVFGLGAFISTIGNAVTVLAPLLAGIAKADGLISFLSTKV
                    *******************************:************.*.**.**********

    N315            PILGTVFTALTGPIGIVLGVLAGLAVAFTIAYKKSETFRNFVNGAIESVKQTFSNFIQFI
    Newman          PILGTVFTALTGPIGIVLGVLAGLAVAFTIAYKKSETFRNFVNGAINSVKQTFSNFIQFI
    USA300_FPR3757  PILGTVFTALTGPIGIVLGVLAGLAVAFTIAYKKSETFRNFVNDAIESVKQTFSNFIQFI
                    *******************************************.**:*************

    N315            QPFIDSVKNIFKQAISAIVDFAKDIWSQINGFFNENGISIVQALQNICNFIKAIFEFILN
    Newman          QPFIDSVKNVFKQAVSAIVDFAKDIWSQINGFFNENGISIVQALQNICNFIKAIFEFILN
    USA300_FPR3757  QPFIDSVKNVFKQAVSAIVDFAKDIWSQINGFFNENGISIVQALQNICNFIKVIFEFILN
                    *********:****:*************************************.*******

    N315            FVIKPIMFAIWQVMQFIWPAVKALIVSTWENIKGVIQGAINIILGIIKVFSSLFTGNWRG
    Newman          FVIKPIMFAIWQVMQFIWPAVKALIVSTWENIKGVIQGALNIILGFIKFFSSLFTGNWRG
    USA300_FPR3757  FVIKPIMFAIWQVMQFIWPAVKALIVSTWENIKGVIQGTLNIILGLIKFFSSLFTGDWRG
                    **************************************::*****:**.*******:***

    N315            VWDGIVMILKGTVQLIWNLIQLWFVGKILGVVRYFGGLLKGLITIIWVAIIGVFKKSLSA
    Newman          VWDGIVMILKGTVQLIWNLIQLWFVGKILGVVRYFGGLLKGLISGIWGVIKGIFTKSLSA
    USA300_FPR3757  VWDAIIMILKGVVQLIWNLIQLWFVGKILGVVRYFGGLLKGLITGIWDVIKSIFSKSLSA
                    ***.*:*****.*******************************: ** .* .:*.*****

    N315            IWNATKSIFGFLFNSVKSIFTNMKNWLSSTWNNIKSNTVGKAHSLFTGVRSKFTSLWNAT
    Newman          IWNATKSIFGFLYNSVKSIFTNMKNWLSSTWNNIKSNTVGKAHSLFTGVRSKFTSLWNAT
    USA300_FPR3757  IWNATKSIFGFLFNSVKSIFTNMKNWLSNTWSSIRTNTIGKAQSLFSGVKSKFTSLWNAT
                    ************:***************.**..*::**:***:***:**:**********

    N315            KDIFIKLRNWMSNIWNSIKDNTVGIAGRLWDRVRNIFGSMRDGLKSIIGKIKDHIGGMVD
    Newman          KDIFTKLRNWMSNIWNSIKDNTVGIAGRLWDRVRNIFGSMRDGLKSIISKIKDHIGGMVD
    USA300_FPR3757  KDIFSNLRNWMANIWNSIKDNTVGIASRLWSKVRGIFTNMRDGLQSIISKIKSHIGGMVD
                    **** :*****:**************.***.:**.** .*****:***.***.*******

    N315            AVKRGLNKLIEGLNWVGGKLGMDKIPKLHTGTEHTHTTTRLVKNGKIARDTFATVGDKGR
    Newman          AVKRGLNKLIEGLNWVGGKLGMDKIPKLHTGTEHTHTTTRLVKNGKIARDTFATVGDKGR
    USA300_FPR3757  AIKKGLNKLIEGLNWVGGKLGMDKIPKLHTGTEHTHTTTRLVKNGKIARDTFATVGDKGR
                    *:*:********************************************************

    N315            GNGPNGFRNEMIEFPNGKRVLTPNTDTTAYLPKGSKVYNGAQTYSMLNGTLPRFSIGTMW
    Newman          GNGPNGFRNEMIEFPNGKRVITPNTDTTAYLPKGSKVYNGAQTYSMLNGTLPRFSLGTMW
    USA300_FPR3757  GNGPNGFRNEIIEFPNGKRVITPNTDTTAYLPKGSKVYNGTQTYSMLNGTLPRFSLGTMW
                    **********:*********:*******************:**************:****

    N315            KDIKSGASSAFNWTKDQIGKGTKWLGDKVGDVLDFIENPGKLLNYILEAFGIDFNSLTKG
    Newman          KDIKSGASSAFNWTKDKIGKGTKWLGDKVGDVLDFMENPGKLLNYILEAFGIDFNSLTKG
    USA300_FPR3757  KDIKSGASSAFNWTKDQIGKGTKWLGDKVGDVLDFMENPGKLLNYILEAFGIDFNSLTKG
                    ****************:******************:************************

    N315            MGIAGDITKAAWSKIKKSATDWIKENLEAMGGGDLVGGILDPDKINYHYGRTAAYTAATG
    Newman          MGIAGDITKAAWSKIKKSATDWIKENLEAMGGGDLVGGILDPDKINYHYGRTAAYTAATG
    USA300_FPR3757  MGIAGDITKAAWSKIKKSATDWIKENLEAMGGGDLVGGILDPDKINYHYGRTAAYTAATG
                    ************************************************************

    N315            RPFHEGVDFPFVYQEVRTPMGGRLTRMPFMSGGYGNYVKITSGVIDMLFAHLKNFSKSPP
    Newman          RPFHEGVDFPFVYQEVRTPMGGRLTRMPFMSGGYGNYVKITSGVIDMLFAHLKNFSKSPP
    USA300_FPR3757  RPFHEGVDFPFVYQEVRTPMGGRLTRMPFMSGGYGNYVKITSGVIDMLFAHLKNFSKSPP
                    ************************************************************

    N315            SGTMVKPGDVVGLTGNTGFSTGPHLHFEMRRNGRHFDPEPYLRNAKKKGRLSIGGGGATS
    Newman          SGTMVKPGDVVGLTGNTGFSTGPHLHFEMRRNGRHFDPEPYLRNAKKKGRLSIGGGGATS
    USA300_FPR3757  SGTMVKPGDVVGLTGNTGFSTGPHLHFEMRRNGRHFDPEPYLRNAKKKGRLSIGGGGATS
                    ************************************************************

    N315            GSGATYASRVIRQAQSILGGRYKGKWIHDQMMRVAKRESNYQSNAVNNWDINAQRGDPSR
    Newman          GSGATYASRVIRQAQSILGGRYKGKWIHDQMMRVAKRESNYQSNAVNNWDINAQRGDPSR
    USA300_FPR3757  GSGATYASRVIRQAQSILGGRYKGKWIHDQMMRVAKRESNYQSNAVNNWDINAQRGDPSR
                    ************************************************************

    N315            GLFQIIGSTFRANAKRGYTNFNNPVHQGISAMQYIVRRYGWDGFKRAGDYAYATGGKVFD
    Newman          GLFQIIGSTFRANAKRGYTNYNNPVHQGISAMQYIVRRYGWGGFKRAGDYAYATGGKVFD
    USA300_FPR3757  GLFQIIGSTFRANAKRGYTNFNNPVHQGISAMQYIVRRYGWDGFKRAGDYAYATGGKVFD
                    ********************:********************.******************

    N315            GWYNLGEDGHPEWVIPTDPARRNDAMKMLHYAAAEVRGKNASKNKRPSQLSSVNGFDDPS
    Newman          GWYNLGEDGHPEWIIPTDPARRNDAMKILHYAAAEVRGKKASKNKRPSQLSDLNGFDDPS
    USA300_FPR3757  GWYNLGEDGHPEWIIPTDPARRNDAMKMLHYAAAEVRGRKASKNKRPSQLSSVNGFDDPS
                    *************:*************:**********::***********.:*******

    N315            LLLKMIEQQQQQIALLLKIAQSNDVIADKDYQPIIDEYAFDKKVNASIEKRERQESTKVK
    Newman          LLLKMIEQQQQQIALLLKIAQSNDVIADKDYQPIIDEYAFDKKVNASIEKRERQESTKVK
    USA300_FPR3757  LLLKMIEQQQQQIALLLKIAQSNDVIADKDYQPIIDEYAFDKKVNASIEKRERQESTKVK
                    ************************************************************

    N315            FRKGGIAIQ
    Newman          FRKGGIAIQ
    USA300_FPR3757  FRKGGIAIQ
                    *********