From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN005102000
  • symbol?:
  • description?: MBL fold metallo-hydrolase

      descriptions from strain specific annotations:

    • MBL fold metallo-hydrolase
    • beta-lactamase superfamily domain protein
    • Metal-dependent hydrolase
    • Metallo-beta-lactamase superfamily domain protein in prophage
    • phage protein
    • phiPVL ORF044-like protein
    • pseudogene
  • strand?: -
  • coordinates?: 5251266..5251751
  • synteny block?: BlockID0039570
  • occurrence?: in 50% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1945
    08BA02176:
    11819-97:
    MS7_2018
    71193:
    ST398NM01_2943
    ECT-R 2:
    ECTR2_1857
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_19070
    JH1:
    SaurJH1_2077
    JH9:
    SaurJH9_2040
    JKD6008:
    JKD6159:
    SAA6159_01919
    LGA251:
    M013:
    MRSA252:
    SAR2084
    MSHR1132:
    SAMSHR1132_18260
    MSSA476:
    SAS1905
    Mu3:
    SAHV_1970
    Mu50:
    SAV1984
    MW2:
    MW1922
    RF122:
    ST398:
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    VC40:

Genome Viewer[edit source | edit]

N315 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MTAGTQRAMDFESHRLCTIKAKQELRIGTWSILPFDIEHDANEPVAFLLQSTLGYKVLYV
    Newman          MTAGTQQAMNFESHRLCTIKAKQELRIGTWSILPFDIEHDANEPVAFLLQSTLGYKVLYV
                    ******:**:**************************************************

    N315            TDTKYLKYKFNGITHMMLEVNYIYEQMQENIKNGSVHSALANRIMESHFSLEHAIGMLKA
    Newman          TDTKYLKYKFNGITHMMLEVNYIYEQMQENIKNGSVHSTLANRIMESHFSLEHAIGMLKA
                    **************************************:*********************

    N315            NDLTRLEEIHLIHLSSQNSNAKYIKSEIQKVTGAPVYVGGL
    Newman          NDLTRLEEIHLIHLSSQNSNAKYIKSEIQKVTGAPVYVGGL
                    *****************************************