From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005125000
  • symbol?:
  • description?: XRE family transcriptional regulator

      descriptions from strain specific annotations:

    • XRE family transcriptional regulator
    • helix-turn-helix domain-containing protein
    • phage cI-like repressor
    • phi77 ORF011-like protein, phage transcriptional repressor
    • phage transcriptional regulator
    • CI-like repressor, phage associated
    • helix-turn-helix family protein
    • peptidase S24 S26A and S26B
    • phage repressor
    • Phage transcriptional repressor
    • putative phage repressor protein
    • repressor-like protein
    • transcription regulator
  • strand?: +
  • coordinates?: 5264707..5269215
  • synteny block?: BlockID0039780
  • occurrence?: in 59% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1959
    08BA02176:
    11819-97:
    MS7_2029
    71193:
    ST398NM01_1552
    ECT-R 2:
    ECTR2_1868
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_19200
    JH1:
    SaurJH1_2091
    JH9:
    SaurJH9_2054
    JKD6008:
    SAA6008_02051
    JKD6159:
    SAA6159_01932
    LGA251:
    M013:
    MRSA252:
    SAR2100
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_1984
    Mu50:
    SAV1998
    MW2:
    RF122:
    ST398:
    T0131:
    SAT0131_02132
    TCH60:
    TW20:
    SATW20_19950
    USA300_TCH1516:
    USA300HOU_2004
    VC40:

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MNKERNIIIAKNIRKFLNDSNMSQKKLAELINIKPSTLSDYLNLRSNPSHGVIQRIADVF
    NCTC8325        MNKERNIIIAKNIRKFLNDSNMSQKKLAELINIKPSTLSDYLNLRSNPSHGVIQRIADVF
    Newman          MNKERNIIIAKNIRKFLNDSNMSQKKLAELINIKPSTLSDYLNLRSNPSHGVIQRIADVF
    USA300_FPR3757  MNKERNIIIAKNIRKFLNDSNMSQKKLAELINIKPSTLSDYLNLRSNPSHGVIQRIADVF
                    ************************************************************

    N315            EVGKSDIDTTYKDDNDITSIYNKLTPPRQENVLNYANEQLEEQNSKGDNVVDINSYKQEK
    NCTC8325        EVGKSDIDTTYKDDNDITSIYNKLTPPRQENVLNYANEQLEEQNSKGDNVVDINSYKQEK
    Newman          EVGKSDIDTTYKDDNDITSIYNKLTPPRQENVLNYANEQLEEQNSKGDNVVDINSYKQEK
    USA300_FPR3757  EVGKSDIDTTYKDDNDITSIYNKLTPPRQENVLNYANEQLEEQNSKGDNVVDINSYKQEK
                    ************************************************************

    N315            TPVNVNGCVSAGVGERLHDETLFTEMVKGPIPTHDLALKVNGDSMEPMFKDGEIIFVEKT
    NCTC8325        TPVNVNGCVSAGVGERLHDETLFTEMVKGPIPTHDLALKVNGDSMEPMFKDGEIIFVEKT
    Newman          TPVNVNGCVSAGVGERLHDETLFTEMVKGPIPTHDLALKVNGDSMEPMFKDGEIIFVEKT
    USA300_FPR3757  TPVNVNGCVSAGVGERLHDETLFTEMVKGPIPTHDLALKVNGDSMEPMFKDGEIIFVEKT
                    ************************************************************

    N315            HNIKNGQIGIFIIEEEAYVKKVFVEDDRLTLVSLNKDYDDLHFYRNESVRLIGKVIL
    NCTC8325        HNIKNGQIGIFIIEEEAYVKKVFVEDDRLTLVSLNKDYDDLHFYRNESVRLIGKVIL
    Newman          HNIKNGQIGIFIIEEEAYVKKVFVEDDRLTLVSLNKDYDDLHFYRNESVRLIGKVIL
    USA300_FPR3757  HNIKNGQIGIFIIEEEAYVKKVFVEDDRLTLVSLNKDYDDLHFYRNESVRLIGKVIL
                    *********************************************************