From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005192000
  • symbol?: lukH
  • description?: succinyl-diaminopimelate desuccinylase

      descriptions from strain specific annotations:

    • succinyl-diaminopimelate desuccinylase
    • Aerolysin/leukocidin family protein
    • leukocidin/hemolysin toxin subunit S
    • Combined leucocidin/ASH4 hemolysin
    • leukocidin/Hemolysin toxin family protein
    • leukocidin/lemolysin toxin family protein
    • leukocidin-like protein 2
    • Leukocidin LukS-PV
    • Leukocidin S subunit
    • leukocidin subunit
    • pseudogene
    • putative leukocidin S subunit
  • strand?: -
  • coordinates?: 5360678..5361679
  • synteny block?: BlockID0040240
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1928 (lukS)
    USA300_FPR3757:
    04-02981:
    SA2981_1967
    08BA02176:
    C248_2028
    11819-97:
    MS7_2037
    71193:
    ST398NM01_2061
    ECT-R 2:
    ECTR2_1877
    ED133:
    SAOV_2042
    ED98:
    SAAV_2073
    HO 5096 0412:
    SAEMRSA15_19280
    JH1:
    SaurJH1_2100
    JH9:
    SaurJH9_2063
    JKD6008:
    SAA6008_02059
    JKD6159:
    SAA6159_01940
    LGA251:
    SARLGA251_18240
    M013:
    M013TW_1977
    MRSA252:
    SAR2108
    MSHR1132:
    SAMSHR1132_18480
    MSSA476:
    SAS1925
    Mu3:
    SAHV_1991
    Mu50:
    SAV2005
    MW2:
    MW1942
    RF122:
    SAB1876c
    ST398:
    SAPIG2061
    T0131:
    SAT0131_02142
    TCH60:
    HMPREF0772_11177
    TW20:
    SATW20_20020
    USA300_TCH1516:
    USA300HOU_2013
    VC40:
    SAVC_08970

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKNKKRVLIASSLSCAILLLSAATTQANSAHKDSQDQNKKEHVDKSQQKDKRNVTNKDKN
    N315            MKNKKRVLIASSLSCAILLLSAATTQANSAHKDSQDQNKKEHVDKSQQKDKRNVTNKDKN
    NCTC8325        MKNKKRVLIASSLSCAILLLSAATTQANSAHKDSQDQNKKEHVDKSQQKDKRNVTNKDKN
    Newman          MKNKKRVLIASSLSCAILLLSAATTQANSAHKDSQDQNKKEHVDKSQQKDKRNVTNKDKN
    USA300_FPR3757  MKNKKRVLIASSLSCAILLLSAATTQANSAHKDSQDQNKKEHVDKSQQKDKRNVTNKDKN
                    ************************************************************

    COL             STAPDDIGKNGKITKRTETVYDEKTNILQNLQFDFIDDPTYDKNVLLVKKQGSIHSNLKF
    N315            STVPDDIGKNGKITKRTETVYDEKTNILQNLQFDFIDDPTYDKNVLLVKKQGSIHSNLKF
    NCTC8325        STAPDDIGKNGKITKRTETVYDEKTNILQNLQFDFIDDPTYDKNVLLVKKQGSIHSNLKF
    Newman          STAPDDIGKNGKITKRTETVYDEKTNILQNLQFDFIDDPTYDKNVLLVKKQGSIHSNLKF
    USA300_FPR3757  STAPDDIGKNGKITKRTETVYDEKTNILQNLQFDFIDDPTYDKNVLLVKKQGSIHSNLKF
                    **.*********************************************************

    COL             ESHKEEKNSNWLKYPSEYHVDFQVKRNRKTEILDQLPKNKISTAKVDSTFSYSSGGKFDS
    N315            ESHKEEKNSNWLKYPSEYHVDFQVKRNRKTEILDQLPKNKISTAKVDSTFSYSSGGKFDS
    NCTC8325        ESHKEEKNSNWLKYPSEYHVDFQVKRNRKTEILDQLPKNKISTAKVDSTFSYSSGGKFDS
    Newman          ESHKEEKNSNWLKYPSEYHVDFQVKRNRKTEILDQLPKNKISTAKVDSTFSYSSGGKFDS
    USA300_FPR3757  ESHKEEKNSNWLKYPSEYHVDFQVKRNRKTEILDQLPKNKISTAKVDSTFSYSSGGKFDS
                    ************************************************************

    COL             TKGIGRTSSNSYSKTISYNQQNYDTIASGKNNNWHVHWSVIANDLKYGGEVKNRNDELLF
    N315            TKGIGRTSSNSYSKTISYNQQNYDTIASGKNNNWHVHWSVIANDLKYGGEVKNRNDELLF
    NCTC8325        TKGIGRTSSNSYSKTISYNQQNYDTIASGKNNNWHVHWSVIANDLKYGGEVKNRNDELLF
    Newman          TKGIGRTSSNSYSKTISYNQQNYDTIASGKNNNWHVHWSVIANDLKYGGEVKNRNDELLF
    USA300_FPR3757  TKGIGRTSSNSYSKTISYNQQNYDTIASGKNNNWHVHWSVIANDLKYGGEVKNRNDELLF
                    ************************************************************

    COL             YRNTRIATVENPELSFASKYRYPALVRSGFNPEFLTYLSNEKSNEKTQFEVTYTRNQDIL
    N315            YRNTRIATVENPELSFASKYRYPALVRSGFNPEFLTYLSNEKSNEKTQFEVTYTRNQDIL
    NCTC8325        YRNTRIATVENPELSFASKYRYPALVRSGFNPEFLTYLSNEKSNEKTQFEVTYTRNQDIL
    Newman          YRNTRIATVENPELSFASKYRYPALVRSGFNPEFLTYLSNEKSNEKTQFEVTYTRNQDIL
    USA300_FPR3757  YRNTRIATVENPELSFASKYRYPALVRSGFNPEFLTYLSNEKSNEKTQFEVTYTRNQDIL
                    ************************************************************

    COL             KNRPGIHYAPPILEKNKDGQRLIVTYEVDWKNKTVKVVDKYSDDNKPYKEG
    N315            KNRPGIHYAPPILEKNKDGQRLIVTYEVDWKNKTVKVVDKYSDDNKPYKEG
    NCTC8325        KNRPGIHYAPPILEKNKDGQRLIVTYEVDWKNKTVKVVDKYSDDNKPYKEG
    Newman          KNRPGIHYAPPILEKNKDGQRLIVTYEVDWKNKTVKVVDKYSDDNKPYKEG
    USA300_FPR3757  KNRPGIHYAPPILEKNKDGQRLIVTYEVDWKNKTVKVVDKYSDDNKPYKEG
                    ***************************************************