From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005287000
  • symbol?: nrgA
  • description?: ammonia permease

      descriptions from strain specific annotations:

    • ammonia permease
    • ammonium transporter
    • ammonium transporter family protein
    • ammonium transporter NrgA (Membrane protein nrgA) (Protein amtB)
    • AMT family ammonium or ammonia transporter
    • probabale ammonium transporter
  • strand?: -
  • coordinates?: 5451509..5452735
  • synteny block?: BlockID0040870
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1848 (nrgA)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1984
    08BA02176:
    C248_2047
    11819-97:
    MS7_2054 (amt)
    71193:
    ST398NM01_2081
    ECT-R 2:
    ECTR2_1894 (amt)
    ED133:
    SAOV_2080c
    ED98:
    SAAV_2091
    HO 5096 0412:
    SAEMRSA15_19510
    JH1:
    SaurJH1_2116
    JH9:
    SaurJH9_2080
    JKD6008:
    SAA6008_02081 (nrgA)
    JKD6159:
    SAA6159_01956 (nrgA)
    LGA251:
    SARLGA251_18450
    M013:
    M013TW_1995
    MRSA252:
    SAR2130
    MSHR1132:
    SAMSHR1132_18650
    MSSA476:
    SAS1948
    Mu3:
    SAHV_2028 (nrgA)
    Mu50:
    SAV2043 (nrgA)
    MW2:
    MW1967 (nrgA)
    RF122:
    SAB1927c
    ST398:
    SAPIG2081
    T0131:
    SAT0131_02193
    TCH60:
    HMPREF0772_11156 (amt)
    TW20:
    SATW20_20260
    USA300_TCH1516:
    USA300HOU_2040 (amtB)
    VC40:
    SAVC_09095

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNLNDTIFMFLCTLLVWLMTPGLSLFYGGLVESKNALNTVMQSMAAIVLVTFVWITVGFT
    N315            MNLNDTIFMFLCTLLVWLMTPGLSLFYGGLVQSKNALNTVMQSMAAIVLVTFVWITVGFT
    NCTC8325        MNLNDTIFMFLCTLLVWLMTPGLSLFYGGLVQSKNALNTVMQSMAAIVLVTFVWITVGFT
    Newman          MNLNDTIFMFLCTLLVWLMTPGLSLFYGGLVQSKNALNTVMQSMAAIVLVTFVWITVGFT
    USA300_FPR3757  MNLNDTIFMFLCTLLVWLMTPGLSLFYGGLVQSKNALNTVMQSMAAIVLVTFVWITVGFT
                    *******************************:****************************

    COL             ISFGNGNLWFGNWEYTFLNHVGFATQEDISPHIPFALFMLFQMMFCTIAISILSGSIAEK
    N315            ISFGNGNLWFGNWEYTFLNHVGFATQEDISPHIPFALFMLFQMMFCTIAISILSGSIAEK
    NCTC8325        ISFGNGNLWFGNWEYTFLNHVGFATQEDISPHIPFALFMLFQMMFCTIAISILSGSIAEK
    Newman          ISFGNGNLWFGNWEYTFLNHVGFATQEDISPHIPFALFMLFQMMFCTIAISILSGSIAEK
    USA300_FPR3757  ISFGNGNLWFGNWEYTFLNHVGFATQEDISPHIPFALFMLFQMMFCTIAISILSGSIAEK
                    ************************************************************

    COL             MKFIPYLLFVVIWTALVYSPVAHWVWGGGWINKLGVLDFAGGTVVHITSGVSGLVLAIMI
    N315            MKFIPYLLFVVIWTALVYSPVAHWVWGGGWINKLGVLDFAGGTVVHITSGVSGLVLAIMI
    NCTC8325        MKFIPYLLFVVIWTALVYSPVAHWVWGGGWINKLGVLDFAGGTVVHITSGVSGLVLAIMI
    Newman          MKFIPYLLFVVIWTALVYSPVAHWVWGGGWINKLGVLDFAGGTVVHITSGVSGLVLAIMI
    USA300_FPR3757  MKFIPYLLFVVIWTALVYSPVAHWVWGGGWINKLGVLDFAGGTVVHITSGVSGLVLAIMI
                    ************************************************************

    COL             GKGNKHSESTPHNLIITLIGGIFVWIGWYGFNVGSAFTFDNIAMLAFTNTVISASAGAIG
    N315            GKGNKHSESTPHNLIITLIGGIFVWIGWYGFNVGSAFTFDNIAMLAFTNTVISASAGAIG
    NCTC8325        GKGNKHSESTPHNLIITLIGGIFVWIGWYGFNVGSAFTFDNIAMLAFTNTVISASAGAIG
    Newman          GKGNKHSESTPHNLIITLIGGIFVWIGWYGFNVGSAFTFDNIAMLAFTNTVISASAGAIG
    USA300_FPR3757  GKGNKHSESTPHNLIITLIGGIFVWIGWYGFNVGSAFTFDNIAMLAFTNTVISASAGAIG
                    ************************************************************

    COL             WLILEYIFKKTTSLLGLLLGALAGLVVITPAAGYVTYLSATIMALIGGICCYIVINYIKV
    N315            WLILEYIFKKTTSLLGLLLGALAGLVVITPAAGYVTYLSATIMALIGGICCYIVINYIKV
    NCTC8325        WLILEYIFKKTTSLLGLLLGALAGLVVITPAAGYVTYLSATIMALIGGICCYIVINYIKV
    Newman          WLILEYIFKKTTSLLGLLLGALAGLVVITPAAGYVTYLSATIMALIGGICCYIVINYIKV
    USA300_FPR3757  WLILEYIFKKTTSLLGLLLGALAGLVVITPAAGYVTYLSATIMALIGGICCYIVINYIKV
                    ************************************************************

    COL             KLKYHDALDAFGIHGVGGIIGAVLTAVFQSKKANPDIENGFIYTGDIHIILVQILCVTAV
    N315            KLKYHDALDAFGIHGVGGIIGAVLTAVFQSKKANPDIENGFIYTGDIHIILVQILCVTAV
    NCTC8325        KLKYHDALDAFGIHGVGGIIGAVLTAVFQSKKANPDIENGFIYTGDIHIILVQILCVTAV
    Newman          KLKYHDALDAFGIHGVGGIIGAVLTAVFQSKKANPDIENGFIYTGDIHIILVQILCVTAV
    USA300_FPR3757  KLKYHDALDAFGIHGVGGIIGAVLTAVFQSKKANPDIENGFIYTGDIHIILVQILCVTAV
                    ************************************************************

    COL             VIFSIVMTFIIAKVIKLITPLSVTEQETNIGLDKIVHGEHAYFEGELNRFNKHIRY
    N315            VIFSIVMTFIIAKVIKLITPLSVTEQETNIGLDKIVHGEHAYFEGELNRFNKHIRY
    NCTC8325        VIFSIVMTFIIAKVIKLITPLSVTEQETNIGLDKIVHGEHAYFEGELNRFNKHIRY
    Newman          VIFSIVMTFIIAKVIKLITPLSVTEQETNIGLDKIVHGEHAYFEGELNRFNKHIRY
    USA300_FPR3757  VIFSIVMTFIIAKVIKLITPLSVTEQETNIGLDKIVHGEHAYFEGELNRFNKHIRY
                    ********************************************************