From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005298000
  • symbol?: gcp
  • description?: DNA-binding/iron metalloprotein/AP endonuclease

      descriptions from strain specific annotations:

    • DNA-binding/iron metalloprotein/AP endonuclease
    • putative DNA-binding/iron metalloprotein/AP endonuclease
    • metalloendopeptidase, , glycoprotease family protein
    • putative glycoprotease
    • UGMP family protein
    • O-sialoglycoprotein endopeptidase
    • putative tRNA threonylcarbamoyladenosine biosynthesis protein Gcp
    • M22 family O-sialoglycoprotein endopeptidase
    • YgjD/Kae1/Qri7 family protein
    • O-sialoglycoprotein endopeptidase (Glycoprotease)
  • strand?: -
  • coordinates?: 5460728..5461753
  • synteny block?: BlockID0040980
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1990
    08BA02176:
    C248_2054
    11819-97:
    MS7_2061 (gcp)
    71193:
    ST398NM01_2088
    ECT-R 2:
    ECTR2_1900
    ED133:
    SAOV_2086c
    ED98:
    SAAV_2097
    HO 5096 0412:
    SAEMRSA15_19570
    JH1:
    SaurJH1_2123 (gcp)
    JH9:
    SaurJH9_2086 (gcp)
    JKD6008:
    SAA6008_02087
    JKD6159:
    SAA6159_01962
    LGA251:
    SARLGA251_18520
    M013:
    M013TW_2002
    MRSA252:
    SAR2136 (gcp)
    MSHR1132:
    SAMSHR1132_18710
    MSSA476:
    SAS1954 (gcp)
    Mu3:
    SAHV_2034
    Mu50:
    SAV2049 (gcp)
    MW2:
    MW1973 (gcp)
    RF122:
    SAB1934c (gcp)
    ST398:
    SAPIG2088
    T0131:
    SAT0131_02202
    TCH60:
    HMPREF0772_11150 (gcp)
    TW20:
    SATW20_21890
    USA300_TCH1516:
    USA300HOU_2044
    VC40:
    SAVC_09125

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKDILILAVETSCDETSVSVIKNGRDILSNTVLSQIESHKRFGGVVPEVASRHHVEGIT
    N315            MTKDILILAVETSCDETSVSVIKNGRDILSNTVLSQIESHKRFGGVVPEVASRHHVEGIT
    NCTC8325        MTKDILILAVETSCDETSVSVIKNGRDILSNTVLSQIESHKRFGGVVPEVASRHHVEGIT
    Newman          MTKDILILAVETSCDETSVSVIKNGRDILSNTVLSQIESHKRFGGVVPEVASRHHVEGIT
    USA300_FPR3757  MTKDILILAVETSCDETSVSVIKNGRDILSNTVLSQIESHKRFGGVVPEVASRHHVEGIT
                    ************************************************************

    COL             ATINEALGDADVSIEDIDAIAVTEGPGLIGALLIGVNAAKALAFAYDKPLIPVHHIAGHI
    N315            TTINEALVDADVSMEDIDAIAVTEGPGLIGALLIGVNAAKALAFAYDKPLIPVHHIAGHI
    NCTC8325        ATINEALGDADVSIEDIDAIAVTEGPGLIGALLIGVNAAKALAFAYDKPLIPVHHIAGHI
    Newman          ATINEALGDADVSIEDIDAIAVTEGPGLIGALLIGVNAAKALAFAYDKPLIPVHHIAGHI
    USA300_FPR3757  ATINEALGDADVSIEDIDAIAVTEGPGLIGALLIGVNAAKALAFAYDKPLIPVHHIAGHI
                    :****** *****:**********************************************

    COL             YANHIEEPLTFPLIALIVSGGHTELVYMKDHLSFEVIGETRDDAVGEAYDKVARTIGLNY
    N315            YANHIEEPLTFPLIALIVSGGHTELVYMKDHLSFEVIGETRDDAVGEAYDKVARTIGLNY
    NCTC8325        YANHIEEPLTFPLIALIVSGGHTELVYMKDHLSFEVIGETRDDAVGEAYDKVARTIGLNY
    Newman          YANHIEEPLTFPLIALIVSGGHTELVYMKDHLSFEVIGETRDDAVGEAYDKVARTIGLNY
    USA300_FPR3757  YANHIEEPLTFPLIALIVSGGHTELVYMKDHLSFEVIGETRDDAVGEAYDKVARTIGLNY
                    ************************************************************

    COL             PGGPQVDRLAAEGEDTYSFPRVWLDKDSYDFSFSGLKSAVINQLHNQRQKNIPIIEANVA
    N315            PGGPQVDRLAAEGEDTYSFPRVWLDKDSYDFSFSGLKSAVINQLHNQRQKNIPIIEANVA
    NCTC8325        PGGPQVDRLAAEGEDTYSFPRVWLDKDSYDFSFSGLKSAVINQLHNQRQKNIPIIEANVA
    Newman          PGGPQVDRLAAEGEDTYSFPRVWLDKDSYDFSFSGLKSAVINQLHNQRQKNIPIIEANVA
    USA300_FPR3757  PGGPQVDRLAAEGEDTYSFPRVWLDKDSYDFSFSGLKSAVINQLHNQRQKNIPIIEANVA
                    ************************************************************

    COL             TSFQNSVVEVLTFKAIQACKEYGVQRLIVAGGVASNKGLRQSLADQCKVNDIQLTIPSPK
    N315            TSFQNSVVEVLTFKAIQACKEYSVQRLIVAGGVASNKGLRQSLADQCKVNDIQLTIPSPK
    NCTC8325        TSFQNSVVEVLTFKAIQACKEYGVQRLIVAGGVASNKGLRQSLADQCKVNDIQLTIPSPK
    Newman          TSFQNSVVEVLTFKAIQACKEYGVQRLIVAGGVASNKGLRQSLADQCKVNDIQLTIPSPK
    USA300_FPR3757  TSFQNSVVEVLTFKAIQACKEYGVQRLIVAGGVASNKGLRQSLADQCKVNDIQLTIPSPK
                    **********************.*************************************

    COL             LCTDNAAMIGVAGHYLYQQGRFADLALNGHSNIDLEEYSAE
    N315            LCTDNAAMIGVAGHSLYQQGRFADLALNGHSNIDLEEYSAE
    NCTC8325        LCTDNAAMIGVAGHYLYQQGRFADLALNGHSNIDLEEYSAE
    Newman          LCTDNAAMIGVAGHYLYQQGRFADLALNGHSNIDLEEYSAE
    USA300_FPR3757  LCTDNAAMIGVAGHYLYQQGRFADLALNGHSNIDLEEYSAE
                    ************** **************************