From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005395000
  • symbol?: atpG
  • description?: ATP synthase F0F1 subunit gamma

      descriptions from strain specific annotations:

    • ATP synthase F0F1 subunit gamma
    • F0F1 ATP synthase subunit gamma
    • ATP synthase gamma chain
    • ATP synthase subunit gamma, AtpG
    • ATP synthase F1 subunit gamma
    • ATP synthase F1 sector gamma subunit
    • ATP synthase F1, gamma subunit
  • strand?: -
  • coordinates?: 5557478..5558296
  • synteny block?: BlockID0041910
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2096 (atpG)
    N315:
    SA1906 (atpG)
    NCTC8325:
    Newman:
    NWMN_2008 (atpG)
    USA300_FPR3757:
    04-02981:
    SA2981_2044 (atpG)
    08BA02176:
    C248_2118 (atpG)
    11819-97:
    MS7_2120 (atpG)
    71193:
    ST398NM01_2146
    ECT-R 2:
    ECTR2_1960 (atpG)
    ED133:
    SAOV_2145c (atpG)
    ED98:
    SAAV_2159 (atpG)
    HO 5096 0412:
    SAEMRSA15_20120 (atpG)
    JH1:
    SaurJH1_2178
    JH9:
    SaurJH9_2140
    JKD6008:
    SAA6008_02142 (atpG)
    JKD6159:
    SAA6159_02018 (atpG)
    LGA251:
    SARLGA251_19050 (atpG)
    M013:
    M013TW_2063
    MRSA252:
    SAR2192 (atpG)
    MSHR1132:
    SAMSHR1132_19270
    MSSA476:
    SAS2007
    Mu3:
    SAHV_2088 (atpG)
    Mu50:
    SAV2104 (atpG)
    MW2:
    MW2028 (atpG)
    RF122:
    SAB1988c (atpG)
    ST398:
    SAPIG2146 (atpG)
    T0131:
    SAT0131_02265
    TCH60:
    HMPREF0772_11087 (atpG)
    TW20:
    SATW20_22420 (atpG)
    USA300_TCH1516:
    USA300HOU_2094 (atpG)
    VC40:
    SAVC_09395

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MASLKEIDTRIKSTKKMKQITKAMNMVSSSKLRRAEKNTKQFTPYMDKMQDAITAVAGAS
    N315            MASLKEIDTRIKSTKKMKQITKAMNMVSSSKLRRAEKNTKQFTPYMDKMQDAITAVAGAS
    NCTC8325        MASLKEIDTRIKSTKKMKQITKAMNMVSSSKLRRAEKNTKQFTPYMDKMQDAITAVAGAS
    Newman          MASLKEIDTRIKSTKKMKQITKAMNMVSSSKLRRAEKNTKQFTPYMDKMQDAITAVAGAS
    USA300_FPR3757  MASLKEIDTRIKSTKKMKQITKAMNMVSSSKLRRAEKNTKQFTPYMDKMQDAITAVAGAS
                    ************************************************************

    COL             SNTNHPMLRPRKITRSGYLVITSDKGLAGAYSANVLKKLITDIEAKHQDSSEYSIVVLGQ
    N315            SNTNHPMLRPRKITRSGYLVITSDKGLAGAYSANVLKKLITDIEAKHQDSSEYSIVVLGQ
    NCTC8325        SNTNHPMLRPRKITRSGYLVITSDKGLAGAYSANVLKKLITDIEAKHQDSSEYSIVVLGQ
    Newman          SNTNHPMLRPRKITRSGYLVITSDKGLAGAYSANVLKKLITDIEAKHQDSSEYSIVVLGQ
    USA300_FPR3757  SNTNHPMLRPRKITRSGYLVITSDKGLAGAYSANVLKKLITDIEAKHQDSSEYSIVVLGQ
                    ************************************************************

    COL             QGVDFLKNRGYDIEYSQVDVPDQPSFKSVQALANHAIDLYSEEEIDELNIYYSHYVSVLE
    N315            QGVDFLKNRGYDIEYSQVDVPDQPSFKSVQALANHAIDLYSEEEIDELNIYYSHYVSVLE
    NCTC8325        QGVDFLKNRGYDIEYSQVDVPDQPSFKSVQALANHAIDLYSEEEIDELNIYYSHYVSVLE
    Newman          QGVDFLKNRGYDIEYSQVDVPDQPSFKSVQALANHAIDLYSEEEIDELNIYYSHYVSVLE
    USA300_FPR3757  QGVDFLKNRGYDIEYSQVDVPDQPSFKSVQALANHAIDLYSEEEIDELNIYYSHYVSVLE
                    ************************************************************

    COL             NKPTSRQVLPLSQEDSSKGHGHLSSYEFEPDKESILSVILPQYVESLIYGTILDAKASEH
    N315            NKPTSRQVLPLSQEDSSKGHGHLSSYEFEPDKESILSVILPQYVESLIYGTILDAKASEH
    NCTC8325        NKPTSRQVLPLSQEDSSKGHGHLSSYEFEPDKESILSVILPQYVESLIYGTILDAKASEH
    Newman          NKPTSRQVLPLSQEDSSKGHGHLSSYEFEPDKESILSVILPQYVESLIYGTILDAKASEH
    USA300_FPR3757  NKPTSRQVLPLSQEDSSKGHGHLSSYEFEPDKESILSVILPQYVESLIYGTILDAKASEH
                    ************************************************************

    COL             ATRMTAMKNATDNATELIDDLSLEYNRARQAEITQQITEIVGGSAALE
    N315            ATRMTAMKNATDNATELIDDLSLEYNRARQAEITQQITEIVGGSAALE
    NCTC8325        ATRMTAMKNATDNATELIDDLSLEYNRARQAEITQQITEIVGGSAALE
    Newman          ATRMTAMKNATDNATELIDDLSLEYNRARQAEITQQITEIVGGSAALE
    USA300_FPR3757  ATRMTAMKNATDNATELIDDLSLEYNRARQAEITQQITEIVGGSAALE
                    ************************************************