From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2008 [new locus tag: NWMN_RS11615 ]
  • pan locus tag?: SAUPAN005395000
  • symbol: atpG
  • pan gene symbol?: atpG
  • synonym:
  • product: F0F1 ATP synthase subunit gamma

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2008 [new locus tag: NWMN_RS11615 ]
  • symbol: atpG
  • product: F0F1 ATP synthase subunit gamma
  • replicon: chromosome
  • strand: -
  • coordinates: 2226956..2227822
  • length: 867
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    GTGGCTTCTCTTAAAGAAATAGATACTCGAATAAAATCAACCAAAAAAATGAAGCAGATT
    ACGAAAGCGATGAACATGGTATCAAGTTCAAAACTTCGTAGAGCTGAAAAAAATACAAAA
    CAATTCACACCATATATGGATAAAATGCAAGATGCAATTACTGCAGTTGCAGGGGCAAGT
    AGCAATACAAACCATCCAATGCTAAGACCTCGTAAAATTACTAGAAGTGGATATTTAGTT
    ATCACGAGTGATAAAGGTTTAGCAGGTGCATATAGTGCAAACGTGCTTAAAAAATTGATT
    ACTGATATTGAAGCGAAACATCAAGATAGTAGCGAATACAGTATTGTAGTTTTAGGGCAA
    CAAGGTGTTGATTTCCTAAAAAATAGAGGTTATGACATTGAGTATTCTCAAGTAGACGTA
    CCTGATCAACCTTCTTTCAAATCTGTTCAAGCACTAGCTAACCATGCTATAGACTTATAC
    AGTGAAGAAGAAATTGATGAATTAAATATATACTATAGTCATTATGTCAGCGTTCTTGAA
    AACAAGCCTACATCTAGACAAGTATTACCATTATCTCAAGAGGATTCTAGTAAGGGGCAT
    GGTCATTTGTCTTCTTATGAATTTGAGCCAGATAAAGAATCTATCTTAAGTGTAATCTTG
    CCTCAATATGTTGAGAGTTTGATTTACGGAACAATATTAGACGCAAAAGCAAGTGAGCAT
    GCAACACGTATGACTGCGATGAAAAATGCCACTGATAATGCAACTGAACTTATTGATGAC
    TTATCATTAGAATATAACAGAGCGAGACAAGCAGAAATTACGCAACAAATTACTGAAATT
    GTTGGTGGTTCCGCAGCGCTTGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    867

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2008 [new locus tag: NWMN_RS11615 ]
  • symbol: AtpG
  • description: F0F1 ATP synthase subunit gamma
  • length: 288
  • theoretical pI: 5.92712
  • theoretical MW: 32106
  • GRAVY: -0.482986

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismEnergy metabolismATP-proton motive force interconversionATP synthase F1, gamma subunit (TIGR01146; EC 3.6.3.14; HMM-score: 325.9)
    alternate F1F0 ATPase, F1 subunit gamma (TIGR03323; EC 3.6.3.-; HMM-score: 83.5)
  • TheSEED:  
    RespirationATP synthasesF0F1-type ATP synthase ATP synthase gamma chain (EC 3.6.3.14) 
  • PFAM:
    no clan definedATP-synt; ATP synthase (PF00231; HMM-score: 306.3)
    T3SSipB; Type III cell invasion protein SipB (PF16535; HMM-score: 12.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    NWMN_2006(atpC)F0F1 ATP synthase subunit epsilon  [1] (data from MRSA252)
    NWMN_1587(citC)isocitrate dehydrogenase  [1] (data from MRSA252)
    NWMN_1483(dnaK)molecular chaperone DnaK  [1] (data from MRSA252)
    NWMN_0745(eno)phosphopyruvate hydratase  [1] (data from MRSA252)
    NWMN_1096(ftsZ)cell division protein FtsZ  [1] (data from MRSA252)
    NWMN_0741(gapA)glyceraldehyde 3-phosphate dehydrogenase 1  [1] (data from MRSA252)
    NWMN_1178(infB)translation initiation factor IF-2  [1] (data from MRSA252)
    NWMN_0961(pdhC)branched-chain alpha-keto acid dehydrogenase subunit E2  [1] (data from MRSA252)
    NWMN_0962(pdhD)dihydrolipoamide dehydrogenase  [1] (data from MRSA252)
    NWMN_0162(pflB)formate acetyltransferase  [1] (data from MRSA252)
    NWMN_0959(phdA)pyruvate dehydrogenase E1 component, alpha subunit  [1] (data from MRSA252)
    NWMN_0960(phdB)pyruvate dehydrogenase E1 component, beta subunit  [1] (data from MRSA252)
    NWMN_1592(pykA)pyruvate kinase  [1] (data from MRSA252)
    NWMN_0500(rplA)50S ribosomal protein L1  [1] (data from MRSA252)
    NWMN_2149(rplB)50S ribosomal protein L2  [1] (data from MRSA252)
    NWMN_2152(rplC)50S ribosomal protein L3  [1] (data from MRSA252)
    NWMN_2151(rplD)50S ribosomal protein L4  [1] (data from MRSA252)
    NWMN_2140(rplE)50S ribosomal protein L5  [1] (data from MRSA252)
    NWMN_2137(rplF)50S ribosomal protein L6  [1] (data from MRSA252)
    NWMN_0501(rplJ)50S ribosomal protein L10  [1] (data from MRSA252)
    NWMN_0499(rplK)50S ribosomal protein L11  [1] (data from MRSA252)
    NWMN_0502(rplL)50S ribosomal protein L7/L12  [1] (data from MRSA252)
    NWMN_2120(rplM)50S ribosomal protein L13  [1] (data from MRSA252)
    NWMN_2133(rplO)50S ribosomal protein L15  [1] (data from MRSA252)
    NWMN_1151(rplS)50S ribosomal protein L19  [1] (data from MRSA252)
    NWMN_1572(rplT)50S ribosomal protein L20  [1] (data from MRSA252)
    NWMN_1549(rplU)50S ribosomal protein L21  [1] (data from MRSA252)
    NWMN_2147(rplV)50S ribosomal protein L22  [1] (data from MRSA252)
    NWMN_2150(rplW)50S ribosomal protein L23  [1] (data from MRSA252)
    NWMN_0464(rplY)50S ribosomal protein L25/general stress protein Ctc  [1] (data from MRSA252)
    NWMN_1166(rpsB)30S ribosomal protein S2  [1] (data from MRSA252)
    NWMN_2146(rpsC)30S ribosomal protein S3  [1] (data from MRSA252)
    NWMN_1613(rpsD)30S ribosomal protein S4  [1] (data from MRSA252)
    NWMN_2135(rpsE)30S ribosomal protein S5  [1] (data from MRSA252)
    NWMN_0357(rpsF)30S ribosomal protein S6  [1] (data from MRSA252)
    NWMN_2119(rpsI)30S ribosomal protein S9  [1] (data from MRSA252)
    NWMN_2127(rpsK)30S ribosomal protein S11  [1] (data from MRSA252)
    NWMN_2143(rpsQ)30S ribosomal protein S17  [1] (data from MRSA252)
    NWMN_2148(rpsS)30S ribosomal protein S19  [1] (data from MRSA252)
    NWMN_0055(spa)immunoglobulin G binding protein A precursor (protein A)  [1] (data from MRSA252)
    NWMN_1326(sucA)2-oxoglutarate dehydrogenase E1 component  [1] (data from MRSA252)
    NWMN_1325(sucB)dihydrolipoamide succinyltransferase  [1] (data from MRSA252)
    NWMN_1569(tig)trigger factor  [1] (data from MRSA252)
    NWMN_0743(tpiA)triosephosphate isomerase  [1] (data from MRSA252)
    NWMN_0510(tufA)elongation factor Tu  [1] (data from MRSA252)
    NWMN_0428ABC transporter substrate-binding protein  [1] (data from MRSA252)
    NWMN_1382DNA-binding protein HU  [1] (data from MRSA252)
    NWMN_1604universal stress protein family protein  [1] (data from MRSA252)
    NWMN_2086alkaline shock protein 23  [1] (data from MRSA252)
    NWMN_24541-pyrroline-5-carboxylate dehydrogenase  [1] (data from MRSA252)
    NWMN_2504malate:quinone oxidoreductase  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.202
    • Ymax_pos: 13
    • Cmax: 0.116
    • Cmax_pos: 38
    • Smax: 0.474
    • Smax_pos: 10
    • Smean: 0.391
    • D: 0.276
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MASLKEIDTRIKSTKKMKQITKAMNMVSSSKLRRAEKNTKQFTPYMDKMQDAITAVAGASSNTNHPMLRPRKITRSGYLVITSDKGLAGAYSANVLKKLITDIEAKHQDSSEYSIVVLGQQGVDFLKNRGYDIEYSQVDVPDQPSFKSVQALANHAIDLYSEEEIDELNIYYSHYVSVLENKPTSRQVLPLSQEDSSKGHGHLSSYEFEPDKESILSVILPQYVESLIYGTILDAKASEHATRMTAMKNATDNATELIDDLSLEYNRARQAEITQQITEIVGGSAALE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]