From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005396000
  • symbol?: atpA
  • description?: ATP synthase F0F1 subunit alpha

      descriptions from strain specific annotations:

    • ATP synthase F0F1 subunit alpha
    • F0F1 ATP synthase subunit alpha
    • ATP synthase alpha chain
    • ATP synthase F1 subunit alpha
    • ATP synthase subunit alpha, AtpA
    • ATP synthase F1 subcomplex subunit alpha
    • ATP synthase F1, alpha subunit
  • strand?: -
  • coordinates?: 5558375..5559883
  • synteny block?: BlockID0041920
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2097 (atpA)
    N315:
    SA1907 (atpA)
    NCTC8325:
    Newman:
    NWMN_2009 (atpA)
    USA300_FPR3757:
    04-02981:
    SA2981_2045 (atpA)
    08BA02176:
    C248_2119 (atpA)
    11819-97:
    MS7_2121 (atpA)
    71193:
    ST398NM01_2147
    ECT-R 2:
    ECTR2_1961 (atpA)
    ED133:
    SAOV_2146c (atpA)
    ED98:
    SAAV_2160 (atpA)
    HO 5096 0412:
    SAEMRSA15_20130 (atpA)
    JH1:
    SaurJH1_2179
    JH9:
    SaurJH9_2141
    JKD6008:
    SAA6008_02143 (atpA)
    JKD6159:
    SAA6159_02019 (atpA)
    LGA251:
    SARLGA251_19060 (atpA)
    M013:
    M013TW_2064
    MRSA252:
    SAR2193 (atpA)
    MSHR1132:
    SAMSHR1132_19280
    MSSA476:
    SAS2008
    Mu3:
    SAHV_2089 (atpA)
    Mu50:
    SAV2105 (atpA)
    MW2:
    MW2029 (atpA)
    RF122:
    SAB1989c (atpA)
    ST398:
    SAPIG2147 (atpA)
    T0131:
    SAT0131_02267
    TCH60:
    HMPREF0772_11086 (atpA)
    TW20:
    SATW20_22430 (atpA)
    USA300_TCH1516:
    USA300HOU_2095 (atpA)
    VC40:
    SAVC_09400

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAIKAEEISALLRSQIENYESEMSVTDVGTVLQIGDGIALIHGLNDVMAGELVEFHNGVL
    N315            MAIKAEEISALLRSQIENYESEMSVTDVGTVLQIGDGIALIHGLNDVMAGELVEFHNGVL
    NCTC8325        MAIKAEEISALLRSQIENYESEMSVTDVGTVLQIGDGIALIHGLNDVMAGELVEFHNGVL
    Newman          MAIKAEEISALLRSQIENYESEMSVTDVGTVLQIGDGIALIHGLNDVMAGELVEFHNGVL
    USA300_FPR3757  MAIKAEEISALLRSQIENYESEMSVTDVGTVLQIGDGIALIHGLNDVMAGELVEFHNGVL
                    ************************************************************

    COL             GLAQNLEESNVGVVILGPYTGITEGDEVKRTGRIMEVPVGEELIGRVVNPLGQPIDGQGP
    N315            GLAQNLEESNVGVVILGPYTGITEGDEVKRTGRIMEVPVGEELIGRVVNPLGQPIDGQGP
    NCTC8325        GLAQNLEESNVGVVILGPYTGITEGDEVKRTGRIMEVPVGEELIGRVVNPLGQPIDGQGP
    Newman          GLAQNLEESNVGVVILGPYTGITEGDEVKRTGRIMEVPVGEELIGRVVNPLGQPIDGQGP
    USA300_FPR3757  GLAQNLEESNVGVVILGPYTGITEGDEVKRTGRIMEVPVGEELIGRVVNPLGQPIDGQGP
                    ************************************************************

    COL             INTTKTRPVEKKATGVMDRKSVDEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTTIAI
    N315            INTTKTRPVEKKATGVMDRKSVDEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTTIAI
    NCTC8325        INTTKTRPVEKKATGVMDRKSVDEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTTIAI
    Newman          INTTKTRPVEKKATGVMDRKSVDEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTTIAI
    USA300_FPR3757  INTTKTRPVEKKATGVMDRKSVDEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTTIAI
                    ************************************************************

    COL             DTILNQKDQGTICIYVAIGQKDSTVRANVEKLRQAGALDYTIVVAASASEPSPLLYIAPY
    N315            DTILNQKDQGTICIYVAIGQKDSTVRANVEKLRQAGALDYTIVVAASASEPSPLLYIAPY
    NCTC8325        DTILNQKDQGTICIYVAIGQKDSTVRANVEKLRQAGALDYTIVVAASASEPSPLLYIAPY
    Newman          DTILNQKDQGTICIYVAIGQKDSTVRANVEKLRQAGALDYTIVVAASASEPSPLLYIAPY
    USA300_FPR3757  DTILNQKDQGTICIYVAIGQKDSTVRANVEKLRQAGALDYTIVVAASASEPSPLLYIAPY
                    ************************************************************

    COL             SGVTMGEEFMFNGKHVLIVYDDLTKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLER
    N315            SGVTMGEEFMFNGKHVLIVYDDLTKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLER
    NCTC8325        SGVTMGEEFMFNGKHVLIVYDDLTKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLER
    Newman          SGVTMGEEFMFNGKHVLIVYDDLTKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLER
    USA300_FPR3757  SGVTMGEEFMFNGKHVLIVYDDLTKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLER
                    ************************************************************

    COL             AAKLNDDLGGGSITALPIIETQAGDISAYVPTNVISITDGQIFLQSDLFFSGVRPAINAG
    N315            AAKLNDDLGGGSITALPIIETQAGDISAYVPTNVISITDGQIFLQSDLFFSGVRPAINAG
    NCTC8325        AAKLNDDLGGGSITALPIIETQAGDISAYVPTNVISITDGQIFLQSDLFFSGVRPAINAG
    Newman          AAKLNDDLGGGSITALPIIETQAGDISAYVPTNVISITDGQIFLQSDLFFSGVRPAINAG
    USA300_FPR3757  AAKLNDDLGGGSITALPIIETQAGDISAYVPTNVISITDGQIFLQSDLFFSGVRPAINAG
                    ************************************************************

    COL             QSVSRVGGSAQINAMKKVAGTLRLDLASYRELESFAQFGSDLDEFTASKLERGKRTVEVL
    N315            QSVSRVGGSAQIKAMKKVAGTLRLDLASYRELESFAQFGSDLDEFTASKLERGKRTVEVL
    NCTC8325        QSVSRVGGSAQIKAMKKVAGTLRLDLASYRELESFAQFGSDLDEFTASKLERGKRTVEVL
    Newman          QSVSRVGGSAQINAMKKVAGTLRLDLASYRELESFAQFGSDLDEFTASKLERGKRTVEVL
    USA300_FPR3757  QSVSRVGGSAQIKAMKKVAGTLRLDLASYRELESFAQFGSDLDEFTASKLERGKRTVEVL
                    ************:***********************************************

    COL             KQDQNKPLPVEHQVLIIYALTKGYLDDIPVVDITRFEDELNHWAESNATELLNEIRETGG
    N315            KQDQNKPLPVEHQVLIIYALTKGYLDDIPVVDITRFEDELNHWAESNATELLNEIRETGG
    NCTC8325        KQDQNKPLPVEHQVLIIYALTKGYLDDIPVVDITRFEDELNHWAESNATELLNEIRETGG
    Newman          KQDQNKPLPVEHQVLIIYALTKGYLDDIPVVDITRFEDELNHWAESNATELLNEIRETGG
    USA300_FPR3757  KQDQNKPLPVEHQVLIIYALTKGYLDDIPVVDITRFEDELNHWAESNATELLNEIRETGG
                    ************************************************************

    COL             LPDAEKFDTAINEFKKSFSKSE
    N315            LPDAEKFDTAINEFKKSFSKSE
    NCTC8325        LPDAEKFDTAINEFKKSFSKSE
    Newman          LPDAEKFDTAINEFKKSFSKSE
    USA300_FPR3757  LPDAEKFDTAINEFKKSFSKSE
                    **********************