From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005397000
  • symbol?: atpH
  • description?: ATP synthase F0F1 subunit delta

      descriptions from strain specific annotations:

    • ATP synthase F0F1 subunit delta
    • F0F1 ATP synthase subunit delta
    • ATP synthase delta chain
    • ATP synthase F1 subunit delta
    • putative ATP synthase delta chain
    • ATP synthase F1, delta subunit
    • ATP synthase F1 sector delta subunit
  • strand?: -
  • coordinates?: 5559905..5560444
  • synteny block?: BlockID0041930
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2098 (atpH)
    N315:
    SA1908 (atpH)
    NCTC8325:
    Newman:
    NWMN_2010 (atpH)
    USA300_FPR3757:
    04-02981:
    SA2981_2046 (atpH)
    08BA02176:
    C248_2120 (atpH)
    11819-97:
    MS7_2122 (atpH)
    71193:
    ST398NM01_2148
    ECT-R 2:
    ECTR2_1962 (atpH)
    ED133:
    SAOV_2147c
    ED98:
    SAAV_2161 (atpH)
    HO 5096 0412:
    SAEMRSA15_20140 (atpH)
    JH1:
    SaurJH1_2180
    JH9:
    SaurJH9_2142
    JKD6008:
    SAA6008_02144 (atpD)
    JKD6159:
    SAA6159_02020 (atpD)
    LGA251:
    SARLGA251_19070 (atpH)
    M013:
    M013TW_2065
    MRSA252:
    SAR2194 (atpH)
    MSHR1132:
    SAMSHR1132_19290
    MSSA476:
    SAS2009
    Mu3:
    SAHV_2090 (atpH)
    Mu50:
    SAV2106 (atpH)
    MW2:
    MW2030 (atpH)
    RF122:
    SAB1990c (atpH)
    ST398:
    SAPIG2148 (atpH)
    T0131:
    SAT0131_02268 (oppB)
    TCH60:
    HMPREF0772_11085 (atpH)
    TW20:
    SATW20_22440 (atpH)
    USA300_TCH1516:
    USA300HOU_2096 (atpH)
    VC40:
    SAVC_09405

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVKVANKYAKALFDVSLDTNNLETINEELTVINEAVKDKIEQLRMVDSNPTQTAEQRREL
    N315            MVKVANKYAKALFDVSLDTNNLETINEELTVINEAVKDKIEQLKMVDSNPTQTAEQRREL
    NCTC8325        MVKVANKYAKALFDVSLDTNNLETINEELTVINEAVKDKIEQLRMVDSNPTQTAEQRREL
    Newman          MVKVANKYAKALFDVSLDTNNLETINEELTVINEAVKDKIEQLRMVDSNPTQTAEQRREL
    USA300_FPR3757  MVKVANKYAKALFDVSLDTNNLETINEELTVINEAVKDKIEQLRMVDSNPTQTAEQRREL
                    *******************************************:****************

    COL             INGVFTDINPYIKNMMYVLADNRHISLIADVFKAFQSLYNGHYNQDFATIESTYELSQEE
    N315            INGVFTDINPYIKNMMYVLADNRHISLIADVFKAFQSLYNGHYNQDFATIESTYELSQEE
    NCTC8325        INGVFTDINPYIKNMMYVLADNRHISLIADVFKAFQSLYNGHYNQDFATIESTYELSQEE
    Newman          INGVFTDINPYIKNMMYVLADNRHISLIADVFKAFQSLYNGHYNQDFATIESTYELSQEE
    USA300_FPR3757  INGVFTDINPYIKNMMYVLADNRHISLIADVFKAFQSLYNGHYNQDFATIESTYELSQEE
                    ************************************************************

    COL             LDKIVKLVTQQTKLSKVIVDTKINPDLIGGFRVKVGTTVLDGSVRNDLVQLQRKFRRVN
    N315            LDKIVKLVTQQTKLSKVIVDTKINPDLIGGFRVKVGTTVLDGSVRNDLVQLQRKFRRVN
    NCTC8325        LDKIVKLVTQQTKLSKVIVDTKINPDLIGGFRVKVGTTVLDGSVRNDLVQLQRKFRRVN
    Newman          LDKIVKLVTQQTKLSKVIVDTKINPDLIGGFRVKVGTTVLDGSVRNDLVQLQRKFRRVN
    USA300_FPR3757  LDKIVKLVTQQTKLSKVIVDTKINPDLIGGFRVKVGTTVLDGSVRNDLVQLQRKFRRVN
                    ***********************************************************