From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005401000
  • symbol?: atpI
  • description?: ATP synthase

      descriptions from strain specific annotations:

    • ATP synthase
    • ATP synthase I
    • ATP synthase I, AtpI
    • ATP synthase I chain family protein
    • putative ATP synthase protein I
  • strand?: -
  • coordinates?: 5562171..5562524
  • synteny block?: BlockID0041970
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2050
    08BA02176:
    C248_2124 (atpI)
    11819-97:
    MS7_2126
    71193:
    ST398NM01_2152
    ECT-R 2:
    ECTR2_1966
    ED133:
    SAOV_2151c
    ED98:
    SAAV_2165
    HO 5096 0412:
    SAEMRSA15_20180 (atpI)
    JH1:
    SaurJH1_2184
    JH9:
    SaurJH9_2146
    JKD6008:
    SAA6008_02148 (atpI)
    JKD6159:
    SAA6159_02024 (atpI)
    LGA251:
    SARLGA251_19110 (atpI)
    M013:
    M013TW_2069
    MRSA252:
    SAR2198 (atpI)
    MSHR1132:
    SAMSHR1132_19330
    MSSA476:
    SAS2013
    Mu3:
    SAHV_2094
    Mu50:
    SAV2110
    MW2:
    MW2034
    RF122:
    SAB1994c (atpI)
    ST398:
    SAPIG2152
    T0131:
    SAT0131_02272
    TCH60:
    HMPREF0772_11081
    TW20:
    SATW20_22480 (atpI)
    USA300_TCH1516:
    USA300HOU_2100
    VC40:
    SAVC_09425

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---------------------------------MSRFYNIFKQFIQYYFYLIIILGGLYL
    N315            ---------------------------------MSRFYNIFKQFIQYYFYLIIILGGLYL
    NCTC8325        MNRIDTTNRLYYHLVCMSGTVFMIDISHTEAYKMSRFYNIFKQFIQYYFYLIIILGGLYL
    Newman          ---------------------------------MSRFYNIFKQFIQYYFYLIIILGGLYL
                                                     ***************************

    COL             YTHHAFILGLIIGVTGSAINTCIFECYLAKAKRPDTMHISTGNMWRYLVAIIACMIWYLN
    N315            YTHHAFILGLIIGVTGSAINTCIFECYLAKAKRPDTMHISTGNMWRYLVAIIACMIWYLN
    NCTC8325        YTHHAFILGLIIGVTGSAINTCIFECYLAKAKRPDTMHISTGNMWRYLVAIIACMIWYLN
    Newman          YTHHAFILGLIIGVTGSAINTCIFECYLAKAKRPDTMHISTGNMWRYLVAIIACMIWYLN
                    ************************************************************

    COL             KAHVSIIGIIIGLMISYVVVIIRPLLKVSK
    N315            KAHVSIIGIIIGLMISYVVVIIRPLLKVSK
    NCTC8325        KAHVSIIGIIIGLMISYVVVIIRPLLKVSK
    Newman          KAHVSIIGIIIGLMISYVVVIIRPLLKVSK
                    ******************************