From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005405000
  • symbol?:
  • description?: TIGR01440 family protein
  • strand?: -
  • coordinates?: 5565764..5566162
  • synteny block?: BlockID0042010
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2054
    08BA02176:
    C248_2128
    11819-97:
    MS7_2130
    71193:
    ST398NM01_2156
    ECT-R 2:
    ECTR2_1970
    ED133:
    SAOV_2155c
    ED98:
    SAAV_2169
    HO 5096 0412:
    SAEMRSA15_20220
    JH1:
    SaurJH1_2188
    JH9:
    SaurJH9_2150
    JKD6008:
    SAA6008_02152
    JKD6159:
    SAA6159_02028
    LGA251:
    SARLGA251_19150
    M013:
    M013TW_2073
    MRSA252:
    SAR2202
    MSHR1132:
    SAMSHR1132_19370
    MSSA476:
    SAS2017
    Mu3:
    SAHV_2098
    Mu50:
    SAV2114
    MW2:
    MW2038
    RF122:
    SAB1998c
    ST398:
    SAPIG2156
    T0131:
    SAT0131_02276
    TCH60:
    HMPREF0772_11077 (ywlG)
    TW20:
    SATW20_22520
    USA300_TCH1516:
    USA300HOU_2104
    VC40:
    SAVC_09445

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKDLTMLLDELKDMSFFNKGDICLIGCSTSEVIGEKIGTVGSMEVAETIFNALDVVSKET
    N315            MKDLTMLLDELKDMSFFNKGDICLIGCSTSEVIGEKIGTVGSMEVAETIFNALDVVSKET
    NCTC8325        MKDLTMLLDELKDMSFFNKGDICLIGCSTSEVIGEKIGTVGSMEVAETIFNALDVVSKET
    Newman          MKDLTMLLDELKDMSFFNKGDICLIGCSTSEVIGEKIGTVGSMEVAETIFNALDVVSKET
    USA300_FPR3757  MKDLTMLLDELKDMSFFNKGDICLIGCSTSEVIGEKIGTVGSMEVAETIFNALDVVSKET
                    ************************************************************

    COL             GVTFAFQGCEHINRAITIEKSQYNPLTMEEVSVVPDVHAGGSLATYAFQHMKDPIVVEHI
    N315            GVTFAFQGCEHINRAITIEKSQYNPLTMEEVSVVPDVHAGGSLATYAFQHMKDPIVVEHI
    NCTC8325        GVTFAFQGCEHINRAITIEKSQYNPLTMEEVSVVPDVHAGGSLATYAFQHMKDPIVVEHI
    Newman          GVTFAFQGCEHINRAITIEKSQYNPLTMEEVSVVPDVHAGGSLATYAFQHMKDPIVVEHI
    USA300_FPR3757  GVTFAFQGCEHINRAITIEKSQYNPLTMEEVSVVPDVHAGGSLATYAFQHMKDPIVVEHI
                    ************************************************************

    COL             TVPCGIDIGQTLIGMHIKHVCVPVRTSVKQVGQAIVTIATSRPKKIGGERAKYQ
    N315            TVPCGIDIGQTLIGMHIKHVCVPVRTSVKQVGQAIVTIATSRPKKIGGERAKYK
    NCTC8325        TVPCGIDIGQTLIGMHIKHVCVPVRTSVKQVGQAIVTIATSRPKKIGGERAKYQ
    Newman          TVPCGIDIGQTLIGMHIKHVCVPVRTSVKQVGQAIVTIATSRPKKIGGERAKYQ
    USA300_FPR3757  TVPCGIDIGQTLIGMHIKHVCVPVRTSVKQVGQAIVTIATSRPKKIGGERAKYQ
                    *****************************************************: