Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005406000
  • symbol?: ptpB
  • description?: phosphatase

      descriptions from strain specific annotations:

    • phosphatase
    • phosphotyrosine protein phosphatase
    • low molecular weight protein-tyrosine-phosphatase
    • protein tyrosine phosphatase
    • low molecular weight phosphotyrosine protein phosphatase
    • Low molecular weight protein-tyrosine-phosphatase ptpB
    • putative low molecular weightprotein-tyrosine-phosphatase
    • chain A, Solution Structure Of A Low Molecular Weight Protein Tyrosine Phosphatase From Bacillus Subtilis
  • strand?: -
  • coordinates?: 5566396..5566850
  • synteny block?: BlockID0042020
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2055
    08BA02176:
    C248_2129
    11819-97:
    MS7_2131 (ptpB)
    71193:
    ST398NM01_2157
    ECT-R 2:
    ECTR2_1971
    ED133:
    SAOV_2156c
    ED98:
    SAAV_2170
    HO 5096 0412:
    SAEMRSA15_20230
    JH1:
    SaurJH1_2189
    JH9:
    SaurJH9_2151
    JKD6008:
    SAA6008_02153
    JKD6159:
    SAA6159_02029
    LGA251:
    SARLGA251_19160
    M013:
    M013TW_2074
    MRSA252:
    SAR2203
    MSHR1132:
    SAMSHR1132_19380
    MSSA476:
    SAS2018
    Mu3:
    SAHV_2099
    Mu50:
    SAV2115
    MW2:
    MW2039
    RF122:
    SAB1999c
    ST398:
    SAPIG2157
    T0131:
    SAT0131_02277
    TCH60:
    HMPREF0772_11076 (ptpB)
    TW20:
    SATW20_22530
    USA300_TCH1516:
    VC40:
    SAVC_09450

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKILFVCTGNTCRSPLAESIAKEVMPNHQFESRGIFAVNNQGVSNYVEDLVEEHHLAETT
    N315            MKILFVCTGNTCRSPLAESIAKEVMPNHQFESRGIFAVNNQGVSNYVEDLVEEHHLAETT
    NCTC8325        MKILFVCTGNTCRSPLAESIAKEVMPNHQFESRGIFAVNNQGVSNYVEDLVEEHHLAETT
    Newman          MKILFVCTGNTCRSPLAESIAKEVMPNHQFESRGIFAVNNQGVSNYVEDLVEEHHLAETT
    USA300_FPR3757  MKILFVCTGNTCRSPLAESIAKEVMPNHQFESRGIFAVNNQGVSNYVEDLVEEHHLAETT
                    ************************************************************

    COL             LSQQFTEADLKADIILTMSYSHKELIEAHFGLQNHVFTLHEYVKEAGEVIDPYGGTKEMY
    N315            LSQQFTEADLKADIILTMSYSHKELIEAHFGLQNHVFTLHEYVKEAGEVIDPYGGTKEMY
    NCTC8325        LSQQFTEADLKADIILTMSYSHKELIEAHFGLQNHVFTLHEYVKEAGEVIDPYGGTKEMY
    Newman          LSQQFTEADLKADIILTMSYSHKELIEAHFGLQNHVFTLHEYVKEAGEVIDPYGGTKEMY
    USA300_FPR3757  LSQQFTEADLKADIILTMSYSHKELIEAHFGLQNHVFTLHEYVKEAGEVIDPYGGTKEMY
                    ************************************************************

    COL             VHTYEELVSLILKLKDIIC
    N315            VHTYEELVSLILKLKDIIC
    NCTC8325        VHTYEELVSLILKLKDIIC
    Newman          VHTYEELVSLILKLKDIIC
    USA300_FPR3757  VHTYEELVSLILKLKDIIC
                    *******************