From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005559000
  • symbol?:
  • description?: hemolysin III

      descriptions from strain specific annotations:

    • hemolysin III
    • putative hemolysin III
    • channel, hemolysin III family protein
    • hemolysin III, putative
    • hemolysin III channel protein
    • hemolysin III family channel protein
    • hemolysin III-like protein
  • strand?: -
  • coordinates?: 5701592..5702280
  • synteny block?: BlockID0043190
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2108
    08BA02176:
    C248_2206
    11819-97:
    MS7_2193
    71193:
    ST398NM01_2230
    ECT-R 2:
    ECTR2_2031
    ED133:
    SAOV_2217c
    ED98:
    SAAV_2231
    HO 5096 0412:
    SAEMRSA15_20750
    JH1:
    SaurJH1_2239
    JH9:
    SaurJH9_2201
    JKD6008:
    SAA6008_02208
    JKD6159:
    SAA6159_02081
    LGA251:
    SARLGA251_19650
    M013:
    M013TW_2136
    MRSA252:
    SAR2261
    MSHR1132:
    SAMSHR1132_20020
    MSSA476:
    SAS2071
    Mu3:
    SAHV_2154
    Mu50:
    SAV2170
    MW2:
    MW2096
    RF122:
    SAB2051c
    ST398:
    SAPIG2230
    T0131:
    SAT0131_02339
    TCH60:
    HMPREF0772_11022
    TW20:
    SATW20_23050
    USA300_TCH1516:
    USA300HOU_2161
    VC40:
    SAVC_09720

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -MSKSTKKSNDTIVETFKDIIPLSFGEEIGNAASHGVAALLTLLVLPYAAVHSYIAHGTL
    N315            MMSKSTKKSNDTIVETFKDIIPLSFGEEIGNAASHGVAALLTLLVLPYAAVHSYIAHGTL
    NCTC8325        -MSKSTKKSNDTIVETFKDIIPLSFGEEIGNAASHGVAALLTLLVLPYAAVHSYIAHGTL
    Newman          MMSKSTKKSNDTIVETFKDIIPLSFGEEIGNAASHGVAALLTLLVLPYAAVHSYIAHGTL
    USA300_FPR3757  -MSKSTKKSNDTIVETFKDIIPLSFGEEIGNAASHGVAALLTLLVLPYAAVHSYIAHGTL
                     ***********************************************************

    COL             ASVSMSIYVISIFMMFISSTIYHSMQNETPHKYILRIIDHSMIYVAISGTYTPILLTVVG
    N315            ASVSMSIYVISIFMMFISSTIYHSMQNETPHKYILRIIDHSMIYVAISGTYTPILLTVVG
    NCTC8325        ASVSMSIYVISIFMMFISSTIYHSMQNETPHKYILRIIDHSMIYVAISGTYTPILLTVVG
    Newman          ASVSMSIYVISIFMMFISSTIYHSMQNETPHKYILRIIDHSMIYVAISGTYTPILLTVVG
    USA300_FPR3757  ASVSMSIYVISIFMMFISSTIYHSMQNETPHKYILRIIDHSMIYVAISGTYTPILLTVVG
                    ************************************************************

    COL             GWIGWTVFILLWGTTLWGILYKSIAVKVNQKLSLIVYLVMGWVGIILLPIIFIRTSWIFI
    N315            GWIGWTVFILLWGTTLWGILYKSIAVKVNQKLSLIVYLVMGWVGIILLPIIFIRTSWIFI
    NCTC8325        GWIGWTVFILLWGTTLWGILYKSIAVKVNQKLSLIVYLVMGWVGIILLPIIFIRTSWIFI
    Newman          GWIGWTVFILLWGTTLWGILYKSIAVKVNQKLSLIVYLVMGWVGIILLPIIFIRTSWIFI
    USA300_FPR3757  GWIGWTVFILLWGTTLWGILYKSIAVKVNQKLSLIVYLVMGWVGIILLPIIFIRTSWIFI
                    ************************************************************

    COL             LFIFLGGVSYTIGAWFYAQKNRPYFHMIWHIFIVIASLLHLIAILYFM
    N315            LFIFLGGVSYTIGAWFYAQKNRPYFHMIWHIFIVIASLLHLIAILYFM
    NCTC8325        LFIFLGGVSYTIGAWFYAQKNRPYFHMIWHIFIVIASLLHLIAILYFM
    Newman          LFIFLGGVSYTIGAWFYAQKNRPYFHMIWHIFIVIASLLHLIAILYFM
    USA300_FPR3757  LFIFLGGVSYTIGAWFYAQKNRPYFHMIWHIFIVIASLLHLIAILYFM
                    ************************************************