From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005610000
  • symbol?: hysA
  • description?: hyaluronate lyase

      descriptions from strain specific annotations:

    • hyaluronate lyase
    • polysaccharide lyase family protein 8
    • hyaluronate lyase precursor
    • hyaluronate lyase (Hyaluronidase) (HYase)
    • hyaluronate lyase precursor 2
    • hyaluronate lyase 2
    • polysaccharide lyase family 8, super-sandwich domain protein
  • strand?: +
  • coordinates?: 5740830..5743277
  • synteny block?: BlockID0043690
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2194 (hysA)
    N315:
    SA2003 (hysA)
    NCTC8325:
    Newman:
    NWMN_2106 (hysA)
    USA300_FPR3757:
    04-02981:
    SA2981_2139 (hysA)
    08BA02176:
    C248_2244 (hysA2)
    11819-97:
    MS7_2224
    71193:
    ST398NM01_2262
    ECT-R 2:
    ECTR2_2063
    ED133:
    SAOV_2247
    ED98:
    SAAV_2263
    HO 5096 0412:
    SAEMRSA15_21070 (hysA2)
    JH1:
    SaurJH1_2271
    JH9:
    SaurJH9_2232
    JKD6008:
    SAA6008_02243 (hysA)
    JKD6159:
    SAA6159_02114
    LGA251:
    SARLGA251_19960 (hysA)
    M013:
    M013TW_2169
    MRSA252:
    SAR2292 (hysA2)
    MSHR1132:
    SAMSHR1132_20330
    MSSA476:
    SAS2103
    Mu3:
    SAHV_2186 (hysA)
    Mu50:
    SAV2202 (hysA)
    MW2:
    MW2129 (hysA)
    RF122:
    SAB2082 (hysA2)
    ST398:
    SAPIG2262
    T0131:
    SAT0131_02378
    TCH60:
    HMPREF0772_10989 (hysA)
    TW20:
    SATW20_23400 (hysA)
    USA300_TCH1516:
    USA300HOU_2197 (hysA)
    VC40:
    SAVC_09900

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTYRIKKWQKLSTITLLMAGVITLNGGEFRSVDKHQIAVADTNVQTPDYEKLRNTWLDVN
    N315            MTYRMKKWQKLSTITLLMAGVITLNGGEFRSIDKHQIAVADTNVQTPDYEKLRNTWLDVN
    NCTC8325        MTYRIKKWQKLSTITLLMAGVITLNGGEFRSVDKHQIAVADTNVQTPDYEKLRNTWLDVN
    Newman          MTYRIKKWQKLSTITLLMAGVITLNGGEFRSVDKHQIAVADTNVQTPDYEKLRNTWLDVN
    USA300_FPR3757  MTYRIKKWQKLSTITLLMAGVITLNGGEFRSVDKHQIAVADTNVQTPDYEKLRNTWLDVN
                    ****:**************************:****************************

    COL             YGYDKYDENNPDMKKKFDATEKEATNLLKEMKTESGRKYLWSGAETLETNSSHMTRTYRN
    N315            YGYDKYDEKNDAMKKKFDATEKEAEKLLSSMKTESGRTYLWDSAKDLDNKSADMTRTYRN
    NCTC8325        YGYDKYDENNPDMKKKFDATEKEATNLLKEMKTESGRKYLWSGAETLETNSSHMTRTYRN
    Newman          YGYDKYDENNPDMKKKFDATEKEATNLLKEMKTESGRKYLWSGAETLETNSSHMTRTYRN
    USA300_FPR3757  YGYDKYDENNPDMKKKFDATEKEATNLLKEMKTESGRKYLWSGAETLETNSSHMTRTYRN
                    ********:*  ************ :**..*******.***..*: *:.:*:.*******

    COL             IEKIAEAMRNPKTTLNTDENKKKVKDALEWLHKNAYGKEPDKKVKELSENFTKT-TGKNT
    N315            IEKIAEAMRHPKTTLNTDENKKKVKDALEWLHKNAYGKEPDNKVKELTENFKITDSSKKK
    NCTC8325        IEKIAEAMRNPKTTLNTDENKKKVKDALEWLHKNAYGKEPDKKVKELSENFTKT-TGKNT
    Newman          IEKIAEAMRNPKTTLNTDENKKKVKDALEWLHKNAYGKEPDKKVKELSENFTKT-TGKNT
    USA300_FPR3757  IEKIAEAMRNPKTTLNTDENKKKVKDALEWLHKNAYGKEPDKKVKELSENFTKT-TGKNT
                    *********:*******************************:*****:***. * :.*:.

    COL             NLNWWDYEIGTPKSLTNTLILLNDQFSNEEKKKFTAPIKTFAPDSDKILSSVGKAELAKG
    N315            ALNWWDYEIGTPRSLTNTLILLNDQFSNEEKKKFTAPIKTFAPKSDEILSSVGKAEPAKG
    NCTC8325        NLNWWDYEIGTPKSLTNTLILLNDQFSNEEKKKFTAPIKTFAPDSDKILSSVGKAELAKG
    Newman          NLNWWDYEIGTPKSLTNTLILLNDQFSNEEKKKFTAPIKTFAPDSDKILSSVGKAELAKG
    USA300_FPR3757  NLNWWDYEIGTPKSLTNTLILLNDQFSNEEKKKFTAPIKTFAPDSDKILSSVGKAELAKG
                     ***********:******************************.**:********* ***

    COL             GNLVDISKVKLLECIIEEDKDMMKKSIDSFNKVFTYVQDSATGKERNGFYKDGSYIDHQD
    N315            GNLVDIAKVKLLESIIEEDKDMMKNSIDSFNKVFTYVQDSATDKERNGFYKDGSYIDHKD
    NCTC8325        GNLVDISKVKLLECIIEEDKDMMKKSIDSFNKVFTYVQDSATGKERNGFYKDGSYIDHQD
    Newman          GNLVDISKVKLLECIIEEDKDMMKKSIDSFNKVFTYVQDSATGKERNGFYKDGSYIDHQD
    USA300_FPR3757  GNLVDISKVKLLECIIEEDKDMMKKSIDSFNKVFTYVQDSATGKERNGFYKDGSYIDHQD
                    ******:******.**********:*****************.***************:*

    COL             VPYTGAYGVVLLEGISQMMPMIKETPFNDKTQNDTTLKSWIDDGFMPLIYKGEMMDLSRG
    N315            VPYTGAYGVVLLEGISQMMPMIKETPFNDKTQNNTTLKSWIDDGFLPLIYKGEMMDLSRG
    NCTC8325        VPYTGAYGVVLLEGISQMMPMIKETPFNDKTQNDTTLKSWIDDGFMPLIYKGEMMDLSRG
    Newman          VPYTGAYGVVLLEGISQMMPMIKETPFNDKTQNDTTLKSWIDDGFMPLIYKGEMMDLSRG
    USA300_FPR3757  VPYTGAYGVVLLEGISQMMPMIKETPFNDKTQNDTTLKSWIDDGFMPLIYKGEMMDLSRG
                    *********************************:***********:**************

    COL             RAISRENETSHSASATVMKSLLRLSDAMDDSTKAKYKKIVKSSVESDSSYKQNDYLNSYS
    N315            RAISRENETSHSASATVMKSLLRLSDAMDDSTKAKYKKIVKTSVKSDSSYGQNDTLSSYS
    NCTC8325        RAISRENETSHSASATVMKSLLRLSDAMDDSTKAKYKKIVKSSVESDSSYKQNDYLNSYS
    Newman          RAISRENETSHSASATVMKSLLRLSDAMDDSTKAKYKKIVKSSVESDSSYKQNDYLNSYS
    USA300_FPR3757  RAISRENETSHSASATVMKSLLRLSDAMDDSTKAKYKKIVKSSVESDSSYKQNDYLNSYS
                    *****************************************:**:***** *** *.***

    COL             DIDKMKSLMTDNSISKNGLTQQLKIYNDMDRVTYHNKDLDFAFGLSMTSKNVARYESING
    N315            DISKMKSLMEDSTISTNGLTQQLKIYNDMDRVTYHNKDLDFAFGLSMTSKNVARYESING
    NCTC8325        DIDKMKSLMTDNSISKNGLTQQLKIYNDMDRVTYHNKDLDFAFGLSMTSKNVARYESING
    Newman          DIDKMKSLMTDNSISKNGLTQQLKIYNDMDRVTYHNKDLDFAFGLSMTSKNVARYESING
    USA300_FPR3757  DIDKMKSLMTDNSISKNGLTQQLKIYNDMDRVTYHNKDLDFAFGLSMTSKNVARYESING
                    **.****** *.:**.********************************************

    COL             ENLKGWHTGAGMSYLYNSDVKHYHDNFWVTADMKRLSGTTTLDNEILKDTDDKKSSKTFV
    N315            ENLKGWHTGAGMSYLYNSDVKHYRDNFWATADMKRLAGTTTLENEEPKGTDVKKSSKTFV
    NCTC8325        ENLKGWHTGAGMSYLYNSDVKHYHDNFWVTADMKRLSGTTTLDNEILKDTDDKKSSKTFV
    Newman          ENLKGWHTGAGMSYLYNSDVKHYHDNFWVTADMKRLSGTTTLDNEILKDTDDKKSSKTFV
    USA300_FPR3757  ENLKGWHTGAGMSYLYNSDVKHYHDNFWVTADMKRLSGTTTLDNEILKDTDDKKSSKTFV
                    ***********************:****.*******:*****:**  *.** ********

    COL             GGTKVDDQHASIGMDFENQDKTLTAKKSYFILNDKIVFLGTGIKSTDSSKNPVTTIENRK
    N315            GGTKFDDQHASIGMDFENQDKTLTAKKSYFILNDKIVFLGTGIKSTDSSKNPVTTIENRK
    NCTC8325        GGTKVDDQHASIGMDFENQDKTLTAKKSYFILNDKIVFLGTGIKSTDSSKNPVTTIENRK
    Newman          GGTKVDDQHASIGMDFENQDKTLTAKKSYFILNDKIVFLGTGIKSTDSSKNPVTTIENRK
    USA300_FPR3757  GGTKVDDQHASIGMDFENQDKTLTAKKSYFILNDKIVFLGTGIKSTDSSKNPVTTIENRK
                    ****.*******************************************************

    COL             ANGYTLYTDDKQTTNSDNQENNSVFLESTDT-KKNIGYHFLNKPKITVKKESHTGKWKEI
    N315            ANGYTLYTDDKQTTASDNQGTNSVFLESTNKPKNNIGYHFLNESKITVKKESHTGKWSDI
    NCTC8325        ANGYTLYTDDKQTTNSDNQENNSVFLESTDT-KKNIGYHFLNKPKITVKKESHTGKWKEI
    Newman          ANGYTLYTDDKQTTNSDNQENNSVFLESTDT-KKNIGYHFLNKPKITVKKESHTGKWKEI
    USA300_FPR3757  ANGYTLYTDDKQTTNSDNQENNSVFLESTDT-KKNIGYHFLNKPKITVKKESHTGKWKEI
                    ************** **** .********:. *:********:.*************.:*

    COL             NKSQKDTQKTDEYYEVTQKHSNSDNKYGYVLYPGLSKDVFKTKKDEVTVVKQEDDFHVVK
    N315            NKSQKQDSKTNQYYEVTQKHSNTDSKYAYVLYPGLSKDDFNTKKDKVTVVKQDDDFHVVK
    NCTC8325        NKSQKDTQKTDEYYEVTQKHSNSDNKYGYVLYPGLSKDVFKTKKDEVTVVKQEDDFHVVK
    Newman          NKSQKDTQKTDEYYEVTQKHSNSDNKYGYVLYPGLSKDVFKTKKDEVTVVKQEDDFHVVK
    USA300_FPR3757  NKSQKDTQKTDEYYEVTQKHSNSDNKYGYVLYPGLSKDVFKTKKDEVTVVKQEDDFHVVK
                    *****: .**::**********:*.**.********** *:****:******:*******

    COL             DNESVWAGVNYSNSTQTFDINNTKVEVKAKGMFILKKKDDNTYECSFYNPESTNSASDIE
    N315            DNESVWAGVNYSNSTQTFDINNTKVEVKAKGMFILKNKDDNTYECSFYNPESTNTASDIE
    NCTC8325        DNESVWAGVNYSNSTQTFDINNTKVEVKAKGMFILKKKDDNTYECSFYNPESTNSASDIE
    Newman          DNESVWAGVNYSNSTQTFDINNTKVEVKAKGMFILKKKDDNTYECSFYNPESTNSASDIE
    USA300_FPR3757  DNESVWAGVNYSNSTQTFDINNTKVEVKAKGMFILKKKDDNTYECSFYNPESTNSASDIE
                    ************************************:*****************:*****

    COL             SKISMTGYSITNKNTSTSNESGVHFELTK
    N315            SKISITGYSITNKNTSTSNESGVHFELTK
    NCTC8325        SKISMTGYSITNKNTSTSNESGVHFELTK
    Newman          SKISMTGYSITNKNTSTSNESGVHFELTK
    USA300_FPR3757  SKISMTGYSITNKNTSTSNESGVHFELTK
                    ****:************************