From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005671000
  • symbol?: cbiO1
  • description?: cobalt transporter ATP-binding subunit

      descriptions from strain specific annotations:

    • cobalt transporter ATP-binding subunit
    • energy-coupling factor transporter ATPase
    • Cobalt import ATP-binding protein CbiO 1
    • ATPase component of general energizing module of ECF transporters
    • ABC superfamily ATP binding cassette transporter, ABC protein
    • ABC transporter ATP-binding protein
    • ABC transporter family protein
    • ATP-binding ABC transporter
    • energy-coupling factor transporter ATP-binding protein EcfA 1
  • strand?: -
  • coordinates?: 5793427..5794287
  • synteny block?: BlockID0044180
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2210 (cbiO)
    N315:
    SA2020 (cbiO)
    NCTC8325:
    Newman:
    NWMN_2123 (cbiO)
    USA300_FPR3757:
    04-02981:
    SA2981_2159
    08BA02176:
    C248_2257
    11819-97:
    MS7_2241 (ecfA1)
    71193:
    ST398NM01_2274
    ECT-R 2:
    ECTR2_2083
    ED133:
    SAOV_2259c
    ED98:
    SAAV_2283 (cbiO)
    HO 5096 0412:
    SAEMRSA15_21200
    JH1:
    SaurJH1_2289 (cbiO)
    JH9:
    SaurJH9_2248 (cbiO)
    JKD6008:
    SAA6008_02258 (cbiO_1)
    JKD6159:
    SAA6159_02128 (cbiO_1)
    LGA251:
    SARLGA251_20070
    M013:
    M013TW_2181
    MRSA252:
    SAR2304 (cbiO)
    MSHR1132:
    SAMSHR1132_20470
    MSSA476:
    SAS2112 (cbiO)
    Mu3:
    SAHV_2205 (cbiO)
    Mu50:
    SAV2221 (cbiO)
    MW2:
    MW2140 (cbiO)
    RF122:
    SAB2094c (cbiO)
    ST398:
    SAPIG2274
    T0131:
    SAT0131_02394
    TCH60:
    HMPREF0772_10977
    TW20:
    SATW20_23550
    USA300_TCH1516:
    USA300HOU_2212 (cbiO)
    VC40:
    SAVC_09975 (cbiO)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTIRFDNVSYTYQKGTPYQHQAIHDVNTEFEQGKYYAIVGQTGSGKSTLIQNINALLKPT
    N315            MTIRFDNVSYTYQKGTPYQHQAIHDVNTEFEQGKYYAIVGQTGSGKSTLIQNINALLKPT
    NCTC8325        MTIRFDNVSYTYQKGTPYQHQAIHDVNTEFEQGKYYAIVGQTGSGKSTLIQNINALLKPT
    Newman          MTIRFDNVSYTYQKGTPYQHQAIHDVNTEFEQGKYYAIVGQTGSGKSTLIQNINALLKPT
    USA300_FPR3757  MTIRFDNVSYTYQKGTPYQHQAIHDVNTEFEQGKYYAIVGQTGSGKSTLIQNINALLKPT
                    ************************************************************

    COL             TGTVTVDDITITHKTKDKYIRPVRKRIGMVFQFPESQLFEDTVEREMIFGPKNFKMNLDE
    N315            TGTVTVDDITITHKTKDKYIRPVRKRIGMVFQFPESQLFEDTVEREMIFGPKNFKMNLDE
    NCTC8325        TGTVTVDDITITHKTKDKYIRPVRKRIGMVFQFPESQLFEDTVEREMIFGPKNFKMNLDE
    Newman          TGTVTVDDITITHKTKDKYIRPVRKRIGMVFQFPESQLFEDTVEREMIFGPKNFKMNLDE
    USA300_FPR3757  TGTVTVDDITITHKTKDKYIRPVRKRIGMVFQFPESQLFEDTVEREMIFGPKNFKMNLDE
                    ************************************************************

    COL             AKNYAHRLLMDLGFSRDVMSQSPFQMSGGQMRKIAIVSILAMNPDIIVVDEPTAGLDPQS
    N315            AKNYAHRLLMDLGFSRDVMSQSPFQMSGGQMRKIAIVSILAMNPDIIVVDEPTAGLDPQS
    NCTC8325        AKNYAHRLLMDLGFSRDVMSQSPFQMSGGQMRKIAIVSILAMNPDIIVVDEPTAGLDPQS
    Newman          AKNYAHRLLMDLGFSRDVMSQSPFQMSGGQMRKIAIVSILAMNPDIIVVDEPTAGLDPQS
    USA300_FPR3757  AKNYAHRLLMDLGFSRDVMSQSPFQMSGGQMRKIAIVSILAMNPDIIVVDEPTAGLDPQS
                    ************************************************************

    COL             KRQVMRLLKSLQTDENKAIILISHDMNEVARYADEVIVMKEGSIVSQTSPKELFKDKKKL
    N315            KRQVMRLLKSLQTDENKAIILISHDMNEVARYADEVIVMKEGSIVSQTSPKELFKDKKKL
    NCTC8325        KRQVMRLLKSLQTDENKAIILISHDMNEVARYADEVIVMKEGSIVSQTSPKELFKDKKKL
    Newman          KRQVMRLLKSLQTDENKAIILISHDMNEVARYADEVIVMKEGSIVSQTSPKELFKDKKKL
    USA300_FPR3757  KRQVMRLLKSLQTDENKAIILISHDMNEVARYADEVIVMKEGSIVSQTSPKELFKDKKKL
                    ************************************************************

    COL             ADWHIGLPEIVQLQYDFEQKYQTKLKDIALTEEAFVSLYKEWQHEK
    N315            ADWHIGLPEIVQLQYDFEQKYQTKLKDIALTEEAFVSLYKEWQHEK
    NCTC8325        ADWHIGLPEIVQLQYDFEQKYQTKLKDIALTEEAFVSLYKEWQHEK
    Newman          ADWHIGLPEIVQLQYDFEQKYQTKLKDIALTEEAFVSLYKEWQHEK
    USA300_FPR3757  ADWHIGLPEIVQLQYDFEQKYQTKLKDIALTEEAFVSLYKEWQHEK
                    **********************************************