From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005695000
  • symbol?: rplP
  • description?: 50S ribosomal protein L16

      descriptions from strain specific annotations:

    • 50S ribosomal protein L16
    • 50S ribosomal protein L16p (L10e)
  • strand?: -
  • coordinates?: 5806737..5807171
  • synteny block?: BlockID0044410
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2232 (rplP)
    N315:
    SA2040 (rplP)
    NCTC8325:
    Newman:
    NWMN_2145 (rplP)
    USA300_FPR3757:
    04-02981:
    SA2981_2181 (rplP)
    08BA02176:
    C248_2279 (rplP)
    11819-97:
    MS7_2263 (rplP)
    71193:
    ST398NM01_2296
    ECT-R 2:
    ECTR2_2105 (rplP)
    ED133:
    SAOV_2280c
    ED98:
    SAAV_2305 (rplP)
    HO 5096 0412:
    SAEMRSA15_21420 (rplP)
    JH1:
    SaurJH1_2311 (rplP)
    JH9:
    SaurJH9_2270 (rplP)
    JKD6008:
    SAA6008_02280 (rplP)
    JKD6159:
    SAA6159_02150 (rplP)
    LGA251:
    SARLGA251_20290 (rplP)
    M013:
    M013TW_2202
    MRSA252:
    SAR2328 (rplP)
    MSHR1132:
    SAMSHR1132_20690
    MSSA476:
    SAS2134 (rplP)
    Mu3:
    SAHV_2227 (rplP)
    Mu50:
    SAV2243 (rplP)
    MW2:
    MW2162 (rplP)
    RF122:
    SAB2115c (rplP)
    ST398:
    SAPIG2296 (rplP)
    T0131:
    SAT0131_02416
    TCH60:
    HMPREF0772_10955 (rplP)
    TW20:
    SATW20_23770 (rplP)
    USA300_TCH1516:
    USA300HOU_p1
    VC40:
    SAVC_10085 (rplP)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLLPKRVKYRRQHRPKTTGRSKGGNYVTFGEFGLQATTTSWITSRQIESARIAMTRYMKR
    N315            MLLPKRVKYRRQHRPKTTGRSKGGNYVTFGEFGLQATTTSWITSRQIESARIAMTRYMKR
    NCTC8325        MLLPKRVKYRRQHRPKTTGRSKGGNYVTFGEFGLQATTTSWITSRQIESARIAMTRYMKR
    Newman          MLLPKRVKYRRQHRPKTTGRSKGGNYVTFGEFGLQATTTSWITSRQIESARIAMTRYMKR
    USA300_FPR3757  MLLPKRVKYRRQHRPKTTGRSKGGNYVTFGEFGLQATTTSWITSRQIESARIAMTRYMKR
                    ************************************************************

    COL             GGKVWIKIFPHTPYTKKPLEVRMGAGKGAVEGWIAVVKPGRILFEVAGVSEEVAREALRL
    N315            GGKVWIKIFPHTPYTKKPLEVRMGAGKGAVEGWIAVVKPGRILFEVAGVSEEVAREALRL
    NCTC8325        GGKVWIKIFPHTPYTKKPLEVRMGAGKGAVEGWIAVVKPGRILFEVAGVSEEVAREALRL
    Newman          GGKVWIKIFPHTPYTKKPLEVRMGAGKGAVEGWIAVVKPGRILFEVAGVSEEVAREALRL
    USA300_FPR3757  GGKVWIKIFPHTPYTKKPLEVRMGAGKGAVEGWIAVVKPGRILFEVAGVSEEVAREALRL
                    ************************************************************

    COL             ASHKLPVKTKFVKREELGGETNES
    N315            ASHKLPVKTKFVKREELGGETNES
    NCTC8325        ASHKLPVKTKFVKREELGGETNES
    Newman          ASHKLPVKTKFVKREELGGETNES
    USA300_FPR3757  ASHKLPVKTKFVKREELGGETNES
                    ************************