From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005705000
  • symbol?: pbuG
  • description?: NCS2 family permease

      descriptions from strain specific annotations:

    • NCS2 family permease
    • xanthine/uracil permease
    • xanthine/uracil permeases family protein
    • xanthine/uracil permease family protein
    • Xanthine/uracil/thiamine/ascorbate permease family protein
    • guanine/hypoxanthine permease pbuG
    • Guanine-hypoxanthine permease
    • Hypoxanthine/guanine permease PbuG
    • inner membrane protein YicO
    • NCS2 family nucleobase:cation symporter-2
    • xanthine/uracil/vitamin C permease
  • strand?: -
  • coordinates?: 5812334..5813512
  • synteny block?: BlockID0044510
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2191
    08BA02176:
    C248_2289
    11819-97:
    MS7_2273 (pbuG)
    71193:
    ST398NM01_2306
    ECT-R 2:
    ECTR2_2115
    ED133:
    SAOV_2290c
    ED98:
    SAAV_2315
    HO 5096 0412:
    SAEMRSA15_21520
    JH1:
    SaurJH1_2321
    JH9:
    SaurJH9_2280
    JKD6008:
    SAA6008_02290
    JKD6159:
    SAA6159_02160
    LGA251:
    SARLGA251_20390
    M013:
    M013TW_2212
    MRSA252:
    SAR2338
    MSHR1132:
    SAMSHR1132_20790
    MSSA476:
    SAS2144
    Mu3:
    SAHV_2237
    Mu50:
    SAV2253
    MW2:
    MW2172
    RF122:
    SAB2125c
    ST398:
    SAPIG2306
    T0131:
    SAT0131_02426
    TCH60:
    HMPREF0772_10945 (yieG)
    TW20:
    SATW20_23870
    USA300_TCH1516:
    USA300HOU_2234
    VC40:
    SAVC_10135

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKNYFQFDKYGTNFKREILGGITTFLSMAYILAVNPQVLSLAGVKGVSEDMKMDQGAIFV
    N315            MKNYFQFDKYGTNFKREILGGITTFLSMAYILAVNPQVLSLAGVKGVSEDMKMDQGAIFV
    NCTC8325        ----------------------------------------------------MDQGAIFV
    Newman          MKNYFQFDKYGTNFKREILGGITTFLSMAYILAVNPQVLSLAGVKGVSEDMKMDQGAIFV
    USA300_FPR3757  ----------------------------------------------------MDQGAIFV
                                                                        ********

    COL             ATALAAFVGSLFMGLIAKYPIALAPGMGLNAFFAFTVVLTMGIPWQVGLTGVLFSGIFFA
    N315            ATALAAFVGSLFMGLIAKYPIALAPGMGLNAFFAFTVVLTMGIPWQVGLTGVLFSGIFFA
    NCTC8325        ATALAAFVGSLFMGLIAKYPIALAPGMGLNAFFAFTVVLTMGIPWQVGLTGVLFSGIFFA
    Newman          ATALAAFVGSLFMGLIAKYPIALAPGMGLNAFFAFTVVLTMGIPWQVGLTGVLFSGIFFA
    USA300_FPR3757  ATALAAFVGSLFMGLIAKYPIALAPGMGLNAFFAFTVVLTMGIPWQVGLTGVLFSGIFFA
                    ************************************************************

    COL             ILTVTGFREVIINAIPYQMKMAVSAGIGLFITFVGLQSSGIIVKNESTLVTLGHLTDPPV
    N315            ILTVTGFREVIINAIPYQMKMAVSAGIGLFITFVGLQSSGIIVKNESTLVTLGHLTDPPV
    NCTC8325        ILTVTGFREVIINAIPYQMKMAVSAGIGLFITFVGLQSSGIIVKNESTLVTLGHLTDPPV
    Newman          ILTVTGFREVIINAIPYQMKMAVSAGIGLFITFVGLQSSGIIVKNESTLVTLGHLTDPPV
    USA300_FPR3757  ILTVTGFREVIINAIPYQMKMAVSAGIGLFITFVGLQSSGIIVKNESTLVTLGHLTDPPV
                    ************************************************************

    COL             LLAIFGIVITVILYAIKLPGSIFIGMIITAIVGMFTGLIQMPSGIVGKIPSIEPTFGAAF
    N315            LLAIFGIVITVILYAIKLPGSIFIGMIITAIVGMFTGLIQMPSGIVGKIPSIEPTFGAAF
    NCTC8325        LLAIFGIVITVILYAIKLPGSIFIGMIITAIVGMFTGLIQMPSGIVGKIPSIEPTFGAAF
    Newman          LLAIFGIVITVILYAIKLPGSIFIGMIITAIVGMFTGLIQMPSGIVGKIPSIEPTFGAAF
    USA300_FPR3757  LLAIFGIVITVILYAIKLPGSIFIGMIITAIVGMFTGLIQMPSGIVGKIPSIEPTFGAAF
                    ************************************************************

    COL             EAFKDPSQLLTIQFLIVILTFLFIDFFDTAGTLVAVATQAGIMKDNKLPRAGRALFSDSL
    N315            EAFKDPSQLLTIQFLIVILTFLFIDFFDTAGTLVAVATQAGIMKDNKLPRAGRALFSDSL
    NCTC8325        EAFKDPSQLLTIQFLIVILTFLFIDFFDTAGTLVAVATQAGIMKDNKLPRAGRALFSDSL
    Newman          EAFKDPSQLLTIQFLIVILTFLFIDFFDTAGTLVAVATQAGIMKDNKLPRAGRALFSDSL
    USA300_FPR3757  EAFKDPSQLLTIQFLIVILTFLFIDFFDTAGTLVAVATQAGIMKDNKLPRAGRALFSDSL
                    ************************************************************

    COL             ATIVGSVFGTTTTTSYIESTSGVAVGARTGFASIVTGCCFLLALFFSPLIAVVTSAVTTP
    N315            ATIVGSVFGTTTTTSYIESTSGVAVGARTGFASIVTGCCFLLALFFSPLIAVVTSAVTTP
    NCTC8325        ATIVGSVFGTTTTTSYIESTSGVAVGARTGFASIVTGCCFLLALFFSPLIAVVTSAVTTP
    Newman          ATIVGSVFGTTTTTSYIESTSGVAVGARTGFASIVTGCCFLLALFFSPLIAVVTSAVTTP
    USA300_FPR3757  ATIVGSVFGTTTTTSYIESTSGVAVGARTGFASIVTGCCFLLALFFSPLIAVVTSAVTTP
                    ************************************************************

    COL             ALVVVGVLMAANFAEINWKSFEVAVPAFITIIMMPLSYSIATGIACGFIFYPITMLISKK
    N315            ALVVVGVLMAANFAEINWKSFEVAVPAFITIIMMPLSYSIATGIACGFIFYPITMLISKK
    NCTC8325        ALVVVGVLMAANFAEINWKSFEVAVPAFITIIMMPLSYSIATGIACGFIFYPITMLISKK
    Newman          ALVVVGVLMAANFAEINWKSFEVAVPAFITIIMMPLSYSIATGIACGFIFYPITMLISKK
    USA300_FPR3757  ALVVVGVLMAANFAEINWKSFEVAVPAFITIIMMPLSYSIATGIACGFIFYPITMLISKK
                    ************************************************************

    COL             HKEVHPIMYVLMVLFILYFIFVHG
    N315            HKEVHPIMYVLMVLFILYFIFVHG
    NCTC8325        HKEVHPIMYVLMVLFILYFIFVHG
    Newman          HKEVHPIMYVLMVLFILYFIFVHG
    USA300_FPR3757  HKEVHPIMYVLMVLFILYFIFVHG
                    ************************