From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005789000
  • symbol?:
  • description?: inositol monophosphatase

      descriptions from strain specific annotations:

    • inositol monophosphatase
    • inositol monophosphatase family protein
    • extragenic supressor protein
    • inositol-phosphate phosphatase
    • Myo-inositol-1(or 4)-monophosphatase
    • suppressor protein suhB
  • strand?: -
  • coordinates?: 5876866..5877673
  • synteny block?: BlockID0045340
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2250
    08BA02176:
    C248_2353
    11819-97:
    MS7_2328
    71193:
    ST398NM01_2362
    ECT-R 2:
    ECTR2_2170
    ED133:
    SAOV_2351c
    ED98:
    SAAV_2373
    HO 5096 0412:
    SAEMRSA15_22090
    JH1:
    SaurJH1_2378
    JH9:
    SaurJH9_2335
    JKD6008:
    SAA6008_02346 (suhB)
    JKD6159:
    SAA6159_02215 (suhB)
    LGA251:
    SARLGA251_20940
    M013:
    M013TW_2268
    MRSA252:
    SAR2395
    MSHR1132:
    SAMSHR1132_21360
    MSSA476:
    SAS2203
    Mu3:
    SAHV_2295
    Mu50:
    SAV2311
    MW2:
    MW2231
    RF122:
    SAB2188c
    ST398:
    SAPIG2362
    T0131:
    SAT0131_02491 (sdhB)
    TCH60:
    HMPREF0772_10884 (suhB)
    TW20:
    SATW20_24420
    USA300_TCH1516:
    USA300HOU_2293 (suhB)
    VC40:
    SAVC_10415

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTDKTLQQIDKLICSWLKQIDNVIPQLIMEMTTETKRHRFDLVTNVDKQIQQQFQQFLAT
    N315            MTDKTLQQIDKLICSWLKQIDNVIPQLIMEMTTETKRHRFDLVTNVDKQIQQQFQQFLAT
    NCTC8325        MTDKTLQQIDKLICSWLKQIDNVIPQLIMEMTTETKRHRFDLVTNVDKQIQQQFQQFLAT
    Newman          MTDKTLQQIDKLICSWLKQIDNVIPQLIMEMTTETKRHRFDLVTNVDKQIQQQFQQFLAT
    USA300_FPR3757  MTDKTLQQIDKLICSWLKQIDNVIPQLIMEMTTETKRHRFDLVTNVDKQIQQQFQQFLAT
                    ************************************************************

    COL             HFPEHQLLAEEKSNEMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYV
    N315            HFPEHQLLAEEKSNEMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYV
    NCTC8325        HFPEHQLLAEEKSNEMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYV
    Newman          HFPEHQLLAEEKSNEMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYV
    USA300_FPR3757  HFPEHQLLAEEKSNEMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYV
                    ************************************************************

    COL             YDYPHKKLYKAIRGEGAFCNGIKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYR
    N315            YDYPHKKLYKAIRGEGAFCNGIKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYR
    NCTC8325        YDYPHKKLYKAIRGEGAFCNGIKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYR
    Newman          YDYPHKKLYKAIRGEGAFCNGIKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYR
    USA300_FPR3757  YDYPHKKLYKAIRGEGAFCNGIKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYR
                    ************************************************************

    COL             LVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPF
    N315            LVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPF
    NCTC8325        LVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPF
    Newman          LVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPF
    USA300_FPR3757  LVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPF
                    ************************************************************

    COL             IISNKACHETVLKILNANGGYQKYR
    N315            IISNKACHETVLKILNANGGYQKYR
    NCTC8325        IISNKACHETVLKILNANGGYQKYR
    Newman          IISNKACHETVLKILNANGGYQKYR
    USA300_FPR3757  IISNKACHETVLKILNANGGYQKYR
                    *************************