From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: saupan005805000
  • symbol?:
  • description?: transcriptional regulator

      descriptions from strain specific annotations:

    • transcriptional regulator
    • RpiR family transcriptional regulator
    • sugar isomerase (SIS)
    • phosphosugar-binding transcriptional regulator
    • Transcriptional regulator, RpiR family
    • helix-turn-helix domain, rpiR family protein
    • hex regulon repressor
    • putative transcriptional regulator
    • RpiR family regulatory protein
  • strand?: +
  • coordinates?: 5892476..5893246
  • synteny block?: BlockID0045500
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2263
    08BA02176:
    C248_2366
    11819-97:
    MS7_2341
    71193:
    ST398NM01_2375
    ECT-R 2:
    ECTR2_2183
    ED133:
    SAOV_2364
    ED98:
    SAAV_2386
    HO 5096 0412:
    SAEMRSA15_22220
    JH1:
    SaurJH1_2392
    JH9:
    SaurJH9_2349
    JKD6008:
    SAA6008_02360
    JKD6159:
    SAA6159_02228
    LGA251:
    SARLGA251_21070
    M013:
    M013TW_2281
    MRSA252:
    SAR2409
    MSHR1132:
    SAMSHR1132_21490
    MSSA476:
    SAS2217
    Mu3:
    SAHV_2308
    Mu50:
    SAV2324
    MW2:
    MW2245
    RF122:
    SAB2201
    ST398:
    SAPIG2375
    T0131:
    SAT0131_02507 (nrdD)
    TCH60:
    HMPREF0772_10871
    TW20:
    SATW20_24560
    USA300_TCH1516:
    USA300HOU_2304
    VC40:
    SAVC_10485

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFLDEHINRNFDKLNDNDLHIAHFINTHIDECKNMKIQDLAQFTHASNATIHRFTRKLGF
    N315            MFLDEHINRNFDKLNDNDLHIAHFINTHIDECKNMKIQDLAQFTHASNATIHRFTRKLGF
    NCTC8325        MFLDEHINRNFDKLNDNDLHIAHFINTHIDECKNMKIQDLAQFTHASNATIHRFTRKLGF
    Newman          MFLDEHINRNFDKLNDNDLHIAHFINTHIDECKNMKIQDLAQFTHASNATIHRFTRKLGF
    USA300_FPR3757  MFLDEHINRNFDKLNDNDLHIAHFINTHIDECKNMKIQDLAQFTHASNATIHRFTRKLGF
                    ************************************************************

    COL             DGYSDFKSYLKFESNKTHQLPSNSIDSFKQEIDSTFSYLERVDYQLLTKKMHTASTIYLY
    N315            DGYSDFKSYLKFESNKTHQLPSNSIDSFKQEIDSTFSYLERVDYQLLTEKMHTASTIYLY
    NCTC8325        DGYSDFKSYLKFESNKTHQLPSNSIDSFKQEIDSTFSYLERVDYQLLTKKMHTASTIYLY
    Newman          DGYSDFKSYLKFESNKTHQLPSNSIDSFKQEIDSTFSYLERVDYQLLTKKMHTASTIYLY
    USA300_FPR3757  DGYSDFKSYLKFESNKTHQLPSNSIDSFKQEIDSTFSYLERVDYQLLTKKMHTASTIYLY
                    ************************************************:***********

    COL             GTGRAQLNVASEAQRILLTLHNHVIVLHDEHELKMILNKSEPNDLFFIISLSGETHELLE
    N315            GTGRAQLNVASEAQRILLTLHNHVIVLHDEHELKMILNKSEPNDLFFIISLSGETHELLE
    NCTC8325        GTGRAQLNVASEAQRILLTLHNHVIVLHDEHELKMILNKSEPNDLFFIISLSGETHELLE
    Newman          GTGRAQLNVASEAQRILLTLHNHVIVLHDEHELKMILNKSEPNDLFFIISLSGETHELLE
    USA300_FPR3757  GTGRAQLNVASEAQRILLTLHNHVIVLHDEHELKMILNKSEPNDLFFIISLSGETHELLE
                    ************************************************************

    COL             VTNLLQLRQKYFISVTTMKDNTLAQKANYNVYVSSNTFYLTDGTDYSSFISYHIFFETLV
    N315            VTNLLQLRQKYFISVTTMKDNTLAQKANYNVYVSSNTFYLTDGTDYSSFISYHIFFETLV
    NCTC8325        VTNLLQLRQKYFISVTTMKDNTLAQKANYNVYVSSNTFYLTDGTDYSSFISYHIFFETLV
    Newman          VTNLLQLRQKYFISVTTMKDNTLAQKANYNVYVSSNTFYLTDGTDYSSFISYHIFFETLV
    USA300_FPR3757  VTNLLQLRQKYFISVTTMKDNTLAQKANYNVYVSSNTFYLTDGTDYSSFISYHIFFETLV
                    ************************************************************

    COL             RKYNEYLLHNDISN
    N315            RKYNEYLLHNDISN
    NCTC8325        RKYNEYLLHNDISN
    Newman          RKYNEYLLHNDISN
    USA300_FPR3757  RKYNEYLLHNDISN
                    **************