From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005922000
  • symbol?: nreC
  • description?: response regulators of two-component regulatory

      descriptions from strain specific annotations:

    • response regulators of two-component regulatory
    • transcriptional regulatory protein DegU
    • DegU family transcriptional regulator
    • two component LuxR family transcriptional regulator
    • response regulator receiver
    • transcriptional regulator DegU family protein
    • transcriptional regulatory protein DegU, putative
    • oxygen regulatory protein NreC
    • Two-component response regulator
    • LuxR family two component transcriptional regulator
    • transcriptional regulatory protein degU (Protease production enhancerprotein)
    • putative response regulator
    • LuxR family DNA-binding response regulator
  • strand?: -
  • coordinates?: 5986888..5987490
  • synteny block?: BlockID0046660
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2328
    08BA02176:
    C248_2438
    11819-97:
    MS7_2406 (nreC)
    71193:
    ST398NM01_2444
    ECT-R 2:
    ECTR2_2250
    ED133:
    SAOV_2437c
    ED98:
    SAAV_2456
    HO 5096 0412:
    SAEMRSA15_22900
    JH1:
    SaurJH1_2463
    JH9:
    SaurJH9_2415
    JKD6008:
    SAA6008_02432 (nreC)
    JKD6159:
    SAA6159_02292 (nreC)
    LGA251:
    SARLGA251_21730 (nreC)
    M013:
    M013TW_2352
    MRSA252:
    SAR2480
    MSHR1132:
    SAMSHR1132_22190
    MSSA476:
    SAS2282
    Mu3:
    SAHV_2375
    Mu50:
    SAV2391
    MW2:
    MW2313
    RF122:
    SAB2270c
    ST398:
    SAPIG2444
    T0131:
    SAT0131_02582
    TCH60:
    HMPREF0772_10796
    TW20:
    SATW20_25210 (nreC)
    USA300_TCH1516:
    USA300HOU_2373
    VC40:
    SAVC_10825

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKIVIADDHAVVRTGFSMILNYQNDMEVVATAADGVEAYQKVMEYKPDVLLMDLSMPPGE
    N315            MKIVIADDHAVVRTGFSMILNYQNDMEVVATAADGVEAYQKVMEYKPDVLLMDLSMPPGE
    NCTC8325        -----------------MILNYQNDMEVVATAADGVEAYQKVMEYKPDVLLMDLSMPPGE
    Newman          MKIVIADDHAVVRTGFSMILNYQNDMEVVATAADGVEAYQKVMEYKPDVLLMDLSMPPGE
    USA300_FPR3757  MKIVIADDHAVVRTGFSMILNYQNDMEVVATAADGVEAYQKVMEYKPDVLLMDLSMPPGE
                                     *******************************************

    COL             SGLIATSKIADSFPETKILILTMFDDEEYLFHVLRNGAKGYILKNAPDEQLLLAIRTVYK
    N315            SGLIATSKIADSFPETKILILTMFDDEEYLFHVLRNGAKGYILKNAPDEQLLLAIRTVYK
    NCTC8325        SGLIATSKIADSFPETKILILTMFDDEEYLFHVLRNGAKGYILKNAPDEQLLLAIRTVYK
    Newman          SGLIATSKIADSFPETKILILTMFDDEEYLFHVLRNGAKGYILKNAPDEQLLLAIRTVYK
    USA300_FPR3757  SGLIATSKIADSFPETKILILTMFDDEEYLFHVLRNGAKGYILKNAPDEQLLLAIRTVYK
                    ************************************************************

    COL             GETYVDMKLTTSLVNEFVSNSNQDTANTTDPFKILSKRELEILPLIAKGYGNKEIAEKLF
    N315            GETYVDMKLTTSLVNEFVSNSNQDTANTTDPFKILSKRELEILPLIAKGYGNKEIAEKLF
    NCTC8325        GETYVDMKLTTSLVNEFVSNSNQDTANTTDPFKILSKRELEILPLIAKGYGNKEIAEKLF
    Newman          GETYVDMKLTTSLVNEFVSNSNQDTANTTDPFKILSKRELEILPLIAKGYGNKEIAEKLF
    USA300_FPR3757  GETYVDMKLTTSLVNEFVSNSNQDTANTTDPFKILSKRELEILPLIAKGYGNKEIAEKLF
                    ************************************************************

    COL             VSVKTVEAHKTHIMTKLGLKSKPELVEYALKKKLLEF
    N315            VSVKTVEAHKTHIMTKLGLKSKPELVEYALKKKLLEF
    NCTC8325        VSVKTVEAHKTHIMTKLGLKSKPELVEYALKKKLLEF
    Newman          VSVKTVEAHKTHIMTKLGLKSKPELVEYALKKKLLEF
    USA300_FPR3757  VSVKTVEAHKTHIMTKLGLKSKPELVEYALKKKLLEF
                    *************************************