From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2389 [new locus tag: SACOL_RS12535 ]
  • pan locus tag?: SAUPAN005922000
  • symbol: SACOL2389
  • pan gene symbol?: nreC
  • synonym:
  • product: transcriptional regulatory protein DegU

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2389 [new locus tag: SACOL_RS12535 ]
  • symbol: SACOL2389
  • product: transcriptional regulatory protein DegU
  • replicon: chromosome
  • strand: -
  • coordinates: 2448232..2448885
  • length: 654
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    TTGAAAATAGTCATTGCCGATGATCACGCTGTTGTCCGTACGGGGTTCTCTATGATTTTA
    AATTATCAAAATGATATGGAAGTTGTTGCAACGGCTGCAGATGGCGTCGAAGCTTACCAA
    AAAGTAATGGAATATAAACCTGATGTGTTACTAATGGATTTAAGTATGCCACCAGGTGAG
    TCAGGTCTTATCGCTACGAGTAAAATTGCTGACAGTTTTCCTGAAACTAAAATACTAATA
    TTAACAATGTTTGATGATGAGGAGTATTTGTTCCATGTGTTGCGTAATGGTGCGAAAGGT
    TACATATTGAAAAATGCACCTGATGAACAATTATTGTTAGCTATTCGAACTGTATATAAA
    GGTGAAACATATGTAGATATGAAACTTACAACATCTTTAGTGAATGAATTTGTATCTAAT
    TCAAATCAGGACACTGCAAACACAACAGATCCTTTTAAAATCTTATCAAAACGAGAACTA
    GAAATATTGCCACTTATTGCCAAAGGTTACGGGAATAAAGAAATTGCAGAGAAATTATTT
    GTATCTGTGAAAACAGTAGAAGCACATAAGACGCATATTATGACAAAGCTTGGCTTAAAG
    AGTAAACCTGAGCTAGTTGAATATGCATTGAAAAAGAAATTATTAGAGTTTTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    654

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2389 [new locus tag: SACOL_RS12535 ]
  • symbol: SACOL2389
  • description: transcriptional regulatory protein DegU
  • length: 217
  • theoretical pI: 5.39357
  • theoretical MW: 24368.2
  • GRAVY: -0.0778802

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesSporulation and germinationsporulation transcription factor Spo0A (TIGR02875; HMM-score: 55)
    LuxR family transcriptional regulatory, chaperone HchA-associated (TIGR03541; HMM-score: 39)
    transcriptional regulator EpsA (TIGR03020; HMM-score: 37.5)
    Signal transductionRegulatory functionsDNA interactionsphosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 35.8)
    Signal transductionSignal transductionTwo-component systemsphosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 35.8)
    MetabolismCentral intermediary metabolismNitrogen metabolismnitrogen regulation protein NR(I) (TIGR01818; HMM-score: 35.6)
    Signal transductionRegulatory functionsDNA interactionsnitrogen regulation protein NR(I) (TIGR01818; HMM-score: 35.6)
    Signal transductionSignal transductionTwo-component systemsnitrogen regulation protein NR(I) (TIGR01818; HMM-score: 35.6)
    Signal transductionRegulatory functionsDNA interactionsPEP-CTERM-box response regulator transcription factor (TIGR02915; HMM-score: 31.7)
    RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 24.5)
    proteobacterial dedicated sortase system response regulator (TIGR03787; HMM-score: 23.5)
    Signal transductionRegulatory functionsDNA interactionsheavy metal response regulator (TIGR01387; HMM-score: 21.7)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 18.8)
    Signal transductionSignal transductionTwo-component systemsTMAO reductase sytem sensor TorS (TIGR02956; EC 2.7.13.3; HMM-score: 11.2)
  • TheSEED:  
    Two-component transcriptional response regulator, LuxR family 
  • PFAM:
    CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 88.1)
    HTH (CL0123) GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 78.1)
    Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 19.4)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 16.5)
    DUF2089; Protein of unknown function (DUF2089) (PF09862; HMM-score: 14.3)
    Sigma70_ECF; ECF sigma factor (PF07638; HMM-score: 14)
    Pilus (CL0327) Pilin_PilX; Minor type IV pilin, PilX (PF11530; HMM-score: 12.9)
    HTH (CL0123) HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 11.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.204
    • Ymax_pos: 33
    • Cmax: 0.226
    • Cmax_pos: 33
    • Smax: 0.325
    • Smax_pos: 27
    • Smean: 0.13
    • D: 0.175
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKIVIADDHAVVRTGFSMILNYQNDMEVVATAADGVEAYQKVMEYKPDVLLMDLSMPPGESGLIATSKIADSFPETKILILTMFDDEEYLFHVLRNGAKGYILKNAPDEQLLLAIRTVYKGETYVDMKLTTSLVNEFVSNSNQDTANTTDPFKILSKRELEILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELVEYALKKKLLEF

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: SACOL2389 (NreC*)
    NreC* (TF) important in Nitrate and nitrite respiration

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  2. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]