From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2393 [new locus tag: SACOL_RS12555 ]
  • pan locus tag?: SAUPAN005926000
  • symbol: narJ
  • pan gene symbol?: narJ
  • synonym:
  • product: respiratory nitrate reductase subunit delta

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2393 [new locus tag: SACOL_RS12555 ]
  • symbol: narJ
  • product: respiratory nitrate reductase subunit delta
  • replicon: chromosome
  • strand: -
  • coordinates: 2451108..2451698
  • length: 591
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGGAGGGATTTTCCGTGATTAATTTCGATAATTTTAAAAAATATCAAGAAAGTTTTGGA
    TATATGGCACAACAGTTATGTTTTCCAGAAAAATTAACTTTTCATCCAAAAACTTTTGAA
    GAAACAATTTCGAAAGATCATCCAGCATATGAAGATTTAGTAGCATTTAGAAATGTAATG
    ATGACATTTTCATTATCAGAAATCAAAGCGATTTATACAGATACATTTGATTTTACGAAA
    AAAGCACCATTATATATGACGTATAACAAATTTGATACGCAAAAAGAACGTGGGCAAATG
    TTAGCTAAATTAAAGGTATTATATGAAATGTTTGGACTAGAAATGGTAGATAATGAACTT
    TCTGATTATCTACCGTTGATGCTTCAATTTTTGCAAGTGGCAGAATGGCGAAATGATCCA
    AGAGCTGAAGAGAATATTCAATTAATCATTATGATTATTGAGGATGGAACATATGTGATG
    GCGAATGCACTTGGTGAAGATAACAATCCATATGCCTATGTGATTCAAGCACTTAGAAAA
    ACATTGAAATTATGTTTGACATCACCAAAAGGAGTGAAACATCATGCTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    591

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2393 [new locus tag: SACOL_RS12555 ]
  • symbol: NarJ
  • description: respiratory nitrate reductase subunit delta
  • length: 196
  • theoretical pI: 5.09662
  • theoretical MW: 22925.3
  • GRAVY: -0.286735

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein fateProtein folding and stabilizationnitrate reductase molybdenum cofactor assembly chaperone (TIGR00684; HMM-score: 65.6)
    DMSO reductase family type II enzyme chaperone (TIGR03482; HMM-score: 26.6)
  • TheSEED:  
    Nitrogen MetabolismNitrogen Metabolism - no subcategoryNitrate and nitrite ammonification Respiratory nitrate reductase delta chain (EC 1.7.99.4) 
  • PFAM:
    no clan definedNitrate_red_del; Nitrate reductase delta subunit (PF02613; HMM-score: 25.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.109
    • Ymax_pos: 37
    • Cmax: 0.119
    • Cmax_pos: 21
    • Smax: 0.144
    • Smax_pos: 31
    • Smean: 0.083
    • D: 0.099
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MEGFSVINFDNFKKYQESFGYMAQQLCFPEKLTFHPKTFEETISKDHPAYEDLVAFRNVMMTFSLSEIKAIYTDTFDFTKKAPLYMTYNKFDTQKERGQMLAKLKVLYEMFGLEMVDNELSDYLPLMLQFLQVAEWRNDPRAEENIQLIIMIIEDGTYVMANALGEDNNPYAYVIQALRKTLKLCLTSPKGVKHHA

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: SACOL2389 (NreC*)
    NreC* (TF) important in Nitrate and nitrite respiration

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]