From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005926000
  • symbol?: narJ
  • description?: nitrate reductase subunit delta

      descriptions from strain specific annotations:

    • nitrate reductase subunit delta
    • nitrate reductase molybdenum cofactor assembly chaperone
    • respiratory nitrate reductase, delta subunit
    • Respiratory nitrate reductase delta chain
    • respiratory nitrate reductase subunit delta
    • respiratory nitrate reductase, subunit delta
    • nitrate reductase delta subunit
  • strand?: -
  • coordinates?: 5989764..5990291
  • synteny block?: BlockID0046700
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2393 (narJ)
    N315:
    NCTC8325:
    Newman:
    NWMN_2295 (narJ)
    USA300_FPR3757:
    04-02981:
    SA2981_2332
    08BA02176:
    C248_2442 (narJ)
    11819-97:
    MS7_2410 (narJ)
    71193:
    ST398NM01_2448
    ECT-R 2:
    ECTR2_2254 (narJ)
    ED133:
    SAOV_2440c
    ED98:
    SAAV_2460 (narJ)
    HO 5096 0412:
    SAEMRSA15_22940 (narJ)
    JH1:
    SaurJH1_2467
    JH9:
    SaurJH9_2419
    JKD6008:
    SAA6008_02436 (narJ)
    JKD6159:
    SAA6159_02296 (narJ)
    LGA251:
    SARLGA251_21770 (narJ)
    M013:
    M013TW_2356
    MRSA252:
    SAR2484 (narJ)
    MSHR1132:
    SAMSHR1132_22230
    MSSA476:
    SAS2286
    Mu3:
    SAHV_2379
    Mu50:
    SAV2395
    MW2:
    MW2317
    RF122:
    SAB2274c (narJ)
    ST398:
    SAPIG2448 (narJ)
    T0131:
    SAT0131_02586
    TCH60:
    HMPREF0772_10792 (narJ)
    TW20:
    SATW20_25250 (narJ)
    USA300_TCH1516:
    USA300HOU_2377 (narJ)
    VC40:
    SAVC_10845

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEGFSVINFDNFKKYQESFGYMAQQLCFPEKLTFHPKTFEETISKDHPAYEDLVAFRNVM
    N315            -----MINFDNFKKYQESFGYMAQQLCFPEKLTFHPKTFEETISKDHPAYEDLVAFRNVM
    NCTC8325        MEGFSVINFDNFKKYQESFGYMAQQLCFPEKLTFHPKTFEETISKDHPAYEDLVAFRNVM
    Newman          MEGFSVINFDNFKKYQESFGYMAQQLCFPEKLTFHPKTFEETISKDHPAYEDLVAFRNVM
    USA300_FPR3757  MEGFSVINFDNFKKYQESFGYMAQQLCFPEKLTFHPKTFEETISKDHPAYEDLVAFRNVM
                         :******************************************************

    COL             MTFSLSEIKAIYTDTFDFTKKAPLYMTYNKFDTQKERGQMLAKLKVLYEMFGLEMVDNEL
    N315            MTFSLSEIKAIYTDTFDFTKKAPLYMTYNKFDTQKERGQMLAKLKVLYEMFGLEMVDNEL
    NCTC8325        MTFSLSEIKAIYTDTFDFTKKAPLYMTYNKFDTQKERGQMLAKLKVLYEMFGLEMVDNEL
    Newman          MTFSLSEIKAIYTDTFDFTKKAPLYMTYNKFDTQKERGQMLAKLKVLYEMFGLEMVDNEL
    USA300_FPR3757  MTFSLSEIKAIYTDTFDFTKKAPLYMTYNKFDTQKERGQMLAKLKVLYEMFGLEMVDNEL
                    ************************************************************

    COL             SDYLPLMLQFLQVAEWRNDPRAEENIQLIIMIIEDGTYVMANALGEDNNPYAYVIQALRK
    N315            SDYLPLMLQFLQVAEWRNDPRAEENIQLIIMIIEDGTYVMANALGEDNNPYAYVIQALRK
    NCTC8325        SDYLPLMLQFLQVAEWRNDPRAEENIQLIIMIIEDGTYVMANALGEDNNPYAYVIQALRK
    Newman          SDYLPLMLQFLQVAEWRNDPRAEENIQLIIMIIEDGTYVMANALGEDNNPYAYVIQALRK
    USA300_FPR3757  SDYLPLMLQFLQVAEWRNDPRAEENIQLIIMIIEDGTYVMANALGEDNNPYAYVIQALRK
                    ************************************************************

    COL             TLKLCLTSPKGVKHHA
    N315            TLKLCLTSPKGVKHHA
    NCTC8325        TLKLCLTSPKGVKHHA
    Newman          TLKLCLTSPKGVKHHA
    USA300_FPR3757  TLKLCLTSPKGVKHHA
                    ****************