From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005980000
  • symbol?:
  • description?: glycerate kinase

      descriptions from strain specific annotations:

    • glycerate kinase
    • putative glycerate kinase
  • strand?: +
  • coordinates?: 6040905..6042056
  • synteny block?: BlockID0047240
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2369
    08BA02176:
    C248_2481
    11819-97:
    MS7_2446
    71193:
    ST398NM01_2484
    ECT-R 2:
    ECTR2_2290
    ED133:
    SAOV_2482
    ED98:
    SAAV_2498
    HO 5096 0412:
    SAEMRSA15_23320
    JH1:
    SaurJH1_2507
    JH9:
    SaurJH9_2458
    JKD6008:
    SAA6008_02473 (glxK)
    JKD6159:
    SAA6159_02330 (glxK)
    LGA251:
    SARLGA251_22130
    M013:
    M013TW_2395
    MRSA252:
    SAR2522
    MSHR1132:
    SAMSHR1132_22600
    MSSA476:
    SAS2324
    Mu3:
    SAHV_2416
    Mu50:
    SAV2432
    MW2:
    MW2356
    RF122:
    SAB2314
    ST398:
    SAPIG2484
    T0131:
    SAT0131_02627
    TCH60:
    HMPREF0772_10756 (glxK)
    TW20:
    SATW20_25610
    USA300_TCH1516:
    USA300HOU_2418 (glxK)
    VC40:
    SAVC_11035

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQLQKIVIAPDSFKESMTAQQVGNIIKQAFTNVYGNTLHYDIIPMADGGEGTTDALMHAT
    N315            MQLQKIVIAPDSFKESMTAQQVGNIIKQAFTNVYGNTLHYDIIPMADGGEGTTDALMHAT
    NCTC8325        MQLQKIVIAPDSFKESMTAQQVGNIIKQAFTNVYGNTLHYDIIPMADGGEGTTDALMHAT
    Newman          MQLQKIVIAPDSFKESMTAQQVGNIIKQAFTNVYGNTLHYDIIPMADGGEGTTDALMHAT
    USA300_FPR3757  MQLQKIVIAPDSFKESMTAQQVGNIIKQAFTNVYGNTLHYDIIPMADGGEGTTDALMHAT
                    ************************************************************

    COL             GATKYTVIVNDPLMRPIEACYARADEQQIAIIEMAAASGLDLLEKEERNPLYTSSYGTGE
    N315            GATKYTVIVNDPLMRPIEACYARADEQQIAIIEMAAASGLDLLEKEERNPLYTSSYGTGE
    NCTC8325        GATKYTVIVNDPLMRPIEACYARADEQQIAIIEMAAASGLDLLEKEERNPLYTSSYGTGE
    Newman          GATKYTVIVNDPLMRPIEACYARADEQQIAIIEMAAASGLDLLEKEERNPLYTSSYGTGE
    USA300_FPR3757  GATKYTVIVNDPLMRPIEACYARADEQQIAIIEMAAASGLDLLEKEERNPLYTSSYGTGE
                    ************************************************************

    COL             LIKDALNHGAKTIILGIGGSATNDGGTGMLSALGVKFTDVNGDLLQMNGANLAHIAQIDI
    N315            LIKDALNHGAKTIILGIGGSATNDGGTGMLSALGVKFTDVNGDLLQMNGANLAHIAQIDI
    NCTC8325        LIKDALNHGAKTIILGIGGSATNDGGTGMLSALGVKFTDVNGDLLQMNGANLAHIAQIDI
    Newman          LIKDALNHGAKTIILGIGGSATNDGGTGMLSALGVKFTDVNGDLLQMNGANLAHIAQIDI
    USA300_FPR3757  LIKDALNHGAKTIILGIGGSATNDGGTGMLSALGVKFTDVNGDLLQMNGANLAHIAQIDI
                    ************************************************************

    COL             TNLDSRLKEVTFKVACDVSNPLLGENGATYIYGPQKGADAKMIPKLDFAMSHYHDKIKMC
    N315            TNLDSRLKEVTFKVACDVSNPLLGENGATYIYGPQKGADAKMIPKLDFAMSHYHDKIKMC
    NCTC8325        TNLDSRLKEVTFKVACDVSNPLLGENGATYIYGPQKGADAKMIPKLDFAMSHYHDKIKMC
    Newman          TNLDSRLKEVTFKVACDVSNPLLGENGATYIYGPQKGADAKMIPKLDFAMSHYHDKIKMC
    USA300_FPR3757  TNLDSRLKEVTFKVACDVSNPLLGENGATYIYGPQKGADAKMIPKLDFAMSHYHDKIKMC
                    ************************************************************

    COL             TGKSVNQIPGSGAAGGMGAALLAFCETTLTKGIDVVFDITDFHQRIKDADLVITGEGRMD
    N315            TGKSVNQIPGSGAAGGMGAALLAFCETTLTKGIDVVFDITDFHQRIKDADLVITGEGRMD
    NCTC8325        TGKSVNQIPGSGAAGGMGAALLAFCETTLTKGIDVVFDITDFHQRIKDADLVITGEGRMD
    Newman          TGKSVNQIPGSGAAGGMGAALLAFCETTLTKGIDVVFDITDFHQRIKDADLVITGEGRMD
    USA300_FPR3757  TGKSVNQIPGSGAAGGMGAALLAFCETTLTKGIDVVFDITDFHQRIKDADLVITGEGRMD
                    ************************************************************

    COL             YQTIFGKTPVGVALAAKQYHIPVIAICGSLGENYQHVYDFGIDSAYSIISSPSTLEDVLQ
    N315            YQTIFGKTPVGVALAAKQYHIPVIAICGSLGENYQHVYDFGIDSAYSIISSPSTLEDVLQ
    NCTC8325        YQTIFGKTPVGVALAAKQYHIPVIAICGSLGENYQHVYDFGIDSAYSIISSPSTLEDVLQ
    Newman          YQTIFGKTPVGVALAAKQYHIPVIAICGSLGENYQHVYDFGIDSAYSIISSPSTLEDVLQ
    USA300_FPR3757  YQTIFGKTPVGVALAAKQYHIPVIAICGSLGENYQHVYDFGIDSAYSIISSPSTLEDVLQ
                    ************************************************************

    COL             NSEQNLLNTATDIARILKLQ
    N315            NSEQNLLNTATDIARILKLQ
    NCTC8325        NSEQNLLNTATDIARILKLQ
    Newman          NSEQNLLNTATDIARILKLQ
    USA300_FPR3757  NSEQNLLNTATDIARILKLQ
                    ********************